(data stored in ACNUC7421 zone)

EMBL: CP001658.PE307

CP001658.PE307       Location/Qualifiers
FT   CDS_pept        complement(361812..362615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23328"
FT                   /protein_id="ACT23328.1"
FT                   /translation="MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTG
FT                   MAPQPREWFAGVDDDTILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGKLMWN
FT                   QTALLQQRAAQLPDRSGDGLRAAIRDVIGNEPVFVHVHRPDVVSQAVSFWRAVQTQVWR
FT                   GHPDPKRDSQAVYHAGAIAHIIRNLRDQENGWRAWFAEEGIDPIDIAYPVLWRNLTAIV
FT                   ASVLDAIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLGLPT"
     atgtcccgcg ctgtgagacc gtatctggtg ctcgccaccc aacgcagcgg cagcacgctg        60
     ctggtggaat cgctgcgcgc gacgggctgt gccggggaac cacaggagtt cttccaatac       120
     ctgcctagca ccgggatggc cccccagccc cgggagtggt tcgctggggt cgacgatgac       180
     acgatcctgc aattgctcga tccgctggac cccggtacac cggacaccgc gacgccggtt       240
     gcctggcgtg agcacgtccg cacctccggt cgcacgccca acggcgtctg gggcggcaag       300
     ttgatgtgga atcagactgc gctgctgcag caacgcgcag cacaattgcc ggatcgctcc       360
     ggggatggct tgcgcgcggc aatccgcgac gtcattggca acgaaccggt tttcgtgcac       420
     gtccaccggc ccgatgtggt gtcacaagcg gtgtcgttct ggcgcgccgt gcaaacccag       480
     gtttggcggg gccatccgga ccccaagcgc gactcgcagg ccgtctacca cgccggtgcc       540
     atcgcccaca tcatcaggaa tctgcgcgat caggaaaacg gctggcgcgc ttggtttgcc       600
     gaggaaggca tcgatccgat cgatatcgcc tacccggtgt tatggcgcaa cctgaccgcg       660
     attgtggcca gtgtgcttga cgccatcggc caggatccca aactggcgcc cgcaccgatg       720
     ctggaacggc aggccaacca gcgctctgat gagtgggtcg accggtaccg agcggaggcg       780
     ccgcggctgg ggctacccac ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page