(data stored in ACNUC7421 zone)

EMBL: CP001658.PE319

CP001658.PE319       Location/Qualifiers
FT   CDS_pept        379999..380715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00312"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23340"
FT                   /protein_id="ACT23340.1"
FT                   /translation="MTRPQALLAVSLAFVATAVYAVMWVGHSQDWGWLHSFDWSLLNAA
FT                   HDIGIKNPAWVRFWDGVSLILGPVVLRPLGLLAAMVALAKRKIRIALLLLACLPLNAIM
FT                   TIAAKSVAHRPRPATALVSAHSTSFPSGHALEATASVLALLTVLLPMLHSRFTRHIAIT
FT                   VGALCVLTVGVARVALNVHHPTDVVAGWALGYLYFLVCLCVFRPPSIFGAQRASHALSP
FT                   PVEVSRQPEPEVDTAR"
     atgactcgcc cgcaagcgct tctcgctgtt tcgctcgctt ttgtcgcaac cgcggtgtat        60
     gccgtcatgt gggtggggca ctcccaggat tggggttggc tgcatagttt cgattggtcg       120
     ttgttgaacg cagcgcacga catcgggata aagaaccctg cgtgggtgcg cttctgggat       180
     ggtgtatccc tgatcttggg cccagtcgtg ctgcggccgc tgggtttgct ggccgcgatg       240
     gtcgcactgg cgaagcgcaa gatacggata gcgttgttgc tgttggcctg tttaccgctc       300
     aacgcgatca tgacgatcgc ggccaaatcc gtggcccacc gcccgcgacc ggcgactgcg       360
     ctggtatctg cccattcgac ttcgtttccg tcagggcatg cgttggaggc gaccgcaagc       420
     gtactcgcgc tgctaaccgt cctgttgccc atgctgcaca gcaggtttac tcggcacatc       480
     gccatcacgg tgggcgcgct gtgcgtgttg acggtcggtg ttgccagggt ggcgttgaac       540
     gtgcatcatc cgaccgacgt tgttgccggc tgggcgctgg ggtacctgta tttcctcgtg       600
     tgcctgtgcg tatttcgacc gccgtcgata ttcggtgccc aacgcgcgtc tcatgctttg       660
     tcgccgccag tggaggtgtc gagacaaccc gaaccggaag tcgacacggc ccgctaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page