(data stored in ACNUC7421 zone)

EMBL: CP001658.PE323

CP001658.PE323       Location/Qualifiers
FT   CDS_pept        383442..385304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00316"
FT                   /product="conserved proline and threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23344"
FT                   /protein_id="ACT23344.1"
FT                   /translation="MYDPLGLSIGTTNLVAAGNGGPPVTRRAVLTLYPHCAPKIGVPSQ
FT                   NPNLIEPGALMSGFVERIGDAVALVSPDGSVHDPDLLLVEALDAMVLTAGADASSSEIA
FT                   IAVPAHWKPGAVHALRNGLRTHVGFVRSGMAPRLVSDAIAALTAVNSELGLPHGSVVGL
FT                   LDFGGSATYVTLVETKSDSRTSDFQPVSATARYQDFSGSQIDQALLLRVIDQFGYGDDV
FT                   DPASTAAVGQLGQLREQCRAAKERLSTDVATELFAELAGCSSSIEMTREQLEDLIQDPL
FT                   TGFIYAFDDMLARHNASWADLAAVVTVGGGANIPLVTQRLSFHTRRPVLTASQPGCAAA
FT                   MGALLLANRGGERDSRTRTSIGLATAAAAGTSVIELPAGDVMVIDHEALTDRELAWSQT
FT                   DFPSEAPARFEGDSYNEGGPCWSMRLNAVEPPKGPAWRRIRVSQLLIGVSAVVAMTAIG
FT                   GVALTLTAIERRPSPLPTPIVPGLAPMPPGSVVPSSRAPTPPPPPSTVAPLPSAAPAPT
FT                   TVAPAPPPPTQVVTTTTAPPVTTTPRPSPTTTTTTAPPSTTTTTEPPVTTTSTIPTIPT
FT                   TTTTVKMTTEWLHVPFLPVPIPVPIPQNPGAGEPQNPFGSLGSG"
     atgtacgacc cgctggggtt gtcgatcggg accacaaacc tggtcgcggc gggtaacgga        60
     ggtccgccgg ttactcgtcg cgccgtgctg accctgtacc cgcattgcgc accgaaaatc       120
     ggtgtgccta gccagaaccc gaacttgatc gagccgggcg ccctaatgag cggctttgtt       180
     gagcgcattg gagatgcggt ggcgctggtg tctcccgacg gatccgtgca cgatccagac       240
     ctcttgctgg tcgaggcgct ggatgcgatg gtgctgaccg ccggtgcgga cgcgagttcc       300
     tcggagatcg ccattgccgt tcccgcgcat tggaagcccg gagctgtaca cgcactgcgt       360
     aacggtttgc ggacgcacgt cggcttcgtc cgcagcggca tggcgccgcg cctggtttcc       420
     gatgcgatcg cggcgttgac cgcggtgaac tcggaattgg gcctgcccca cggcagtgtg       480
     gtggggttgc ttgatttcgg tggctccgcg acttacgtca ccttggtgga gaccaagtcg       540
     gattccagga cgtcggattt ccagcccgtt agtgccacgg cacggtacca ggacttttcc       600
     ggtagtcaga tcgaccaggc tttgctgctt cgggtcatcg accaattcgg gtacggcgat       660
     gacgtcgatc cggccagtac cgccgcggtc gggcaactcg gccaactcag ggagcagtgc       720
     cgtgcggcaa aggaacgact gtccaccgac gttgccacgg aattgttcgc tgagcttgcc       780
     gggtgcagct cgagcatcga gatgactcgg gaacagctcg aagacctgat ccaggatcca       840
     ttgaccggct tcatctacgc gttcgacgac atgctggcgc gccacaacgc gagctgggcg       900
     gatctcgcgg cggtggtcac cgtcggcggt ggtgccaata ttccccttgt gactcaacgt       960
     ctttcgttcc acactcgtcg acctgtgctg accgcgtcgc aacccgggtg cgcggcggcg      1020
     atgggtgcgt tgctgctcgc caaccgtggg ggagagcgcg attcgcgaac gcggacgtcc      1080
     atcggcctcg ccacggccgc agccgccggc accagtgtca tcgagctgcc ggccggcgac      1140
     gtcatggtca tcgaccatga ggccttgacc gatcgcgagt tggcctggtc gcagaccgac      1200
     ttcccaagcg aagctccggc gcgtttcgag ggcgactcgt ataacgaagg cggcccctgc      1260
     tggtcgatgc gtctgaacgc ggtcgagccc cccaaaggac cagcgtggcg gcgaatccgg      1320
     gtgtcgcagt tgctcatcgg ggtgtcggcg gtagtggcca tgaccgcgat cgggggcgtg      1380
     gcattgacgt tgacagccat cgagagacgc ccaagcccgc taccaacccc aattgtgccc      1440
     ggcctggccc cgatgccgcc cggatccgtc gtgcctagct cgcgcgcacc gaccccgccg      1500
     ccaccgccgt cgaccgttgc gccgcttccc agtgcggcac cggccccgac gacggtcgcg      1560
     ccggcaccgc cgccgcccac acaggtggtg acgaccacga cagcgccacc cgtcaccacg      1620
     acgccgaggc cgtcgccgac caccacaacg accaccgcgc caccgtcgac aacgacgaca      1680
     accgagccgc cggtgacgac cacttcgacg attccaacga ttccgacgac tacgacgacg      1740
     gtgaagatga ccacggagtg gttgcacgtc ccgtttttgc ccgttccgat cccggtcccg      1800
     attccgcaaa atccgggtgc cggcgaaccg cagaacccgt tcggaagcct tggctctggg      1860
     tga                                                                    1863
//

If you have problems or comments...

PBIL Back to PBIL home page