(data stored in ACNUC7421 zone)

EMBL: CP001658.PE324

CP001658.PE324       Location/Qualifiers
FT   CDS_pept        385376..385762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23345"
FT                   /protein_id="ACT23345.1"
FT                   /translation="MGDYGPFGFDPDEFDRVIREGSEGLRDAFERIGRFLSSSGAGTGW
FT                   SAIFEDLSRRSRPAPETAGEAGDGVWAIYTVDADGGARVEQVYATELDALRANKDNTDP
FT                   KRKVRFLPYGIAVSVLDDPVDEAQ"
     gtgggcgact atggtccgtt tggattcgat cccgacgaat tcgatcgggt gatccgggag        60
     gggagcgagg gactgcgcga cgcgttcgag cggatcggca ggttcctcag ctcatccggc       120
     gcgggaacgg gctggtcggc aatcttcgag gacttgtccc ggcgctcgcg tccggcgccg       180
     gagaccgccg gcgaggccgg tgacggtgtg tgggccatct atacggtgga cgccgacggt       240
     ggtgcccgcg ttgaacaggt gtatgcgacc gagcttgacg ccctgcgcgc gaacaaggac       300
     aacaccgacc cgaaacgcaa agtccgcttc ctgccatacg gcatcgcggt cagcgtcctc       360
     gacgatccgg tggacgaggc ccagtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page