(data stored in ACNUC7421 zone)

EMBL: CP001658.PE329

CP001658.PE329       Location/Qualifiers
FT   CDS_pept        complement(389191..389985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00322"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23350"
FT                   /protein_id="ACT23350.1"
FT                   /translation="MSLAVTMFKRARAEIFDRNREVGISNVTTAASLVTFPVLAGILGG
FT                   VVPSVRTPSAAMVSGVQHFAAGIVMAAVAGEVLPDLRSRGPLWLIVVGFSAGVAVLVAL
FT                   RRFDGHGEHQDGDDVGELPVGFLTVVAVDLFIDGLLVATGATVSSRTAIIITIALTVEV
FT                   LFLGLAVALRLAGSGMPRIRAAATTSALSLVIAVGGVSGAVALGRAGNTVLTLVLAFAA
FT                   AALLWLVVEELLVEAHETPERPWMAVMFFAGFLILYGLGVME"
     ttgtcactag ccgtcacaat gttcaagcgt gcccgagccg agatcttcga ccgaaaccgg        60
     gaggttggca tcagcaacgt cacaacggcc gcctcgttgg tcaccttccc ggttctcgcc       120
     gggattctcg gcggcgtggt cccgtcggtg cgcacgccgt cggcggcgat ggtcagcggc       180
     gtccaacatt tcgccgcggg aattgtcatg gccgccgtgg ccggggaagt gctaccagac       240
     ctgcgcagca gaggtccgct ctggctgatc gttgtgggct tcagtgcagg cgtcgcggta       300
     ctcgttgcac tgcgccgatt tgacggccac ggggaacatc aagacggcga cgacgtgggc       360
     gaactgcccg tcgggttcct caccgtagtc gcggttgacc tcttcatcga cgggttgctg       420
     gtcgcaacgg gcgcgacggt gtccagtcgc accgcgatca tcatcaccat cgccctgacg       480
     gtcgaggtgc tgttcctggg tctggcggtg gccctgcgcc tggccggctc cggaatgcct       540
     aggatccggg ccgcggcgac cacaagcgcc ctgagcctag tgatcgcggt gggcggtgtg       600
     tcaggtgccg tggcgctggg ccgggcggga aataccgtcc tgaccctcgt gttggcgttc       660
     gcggcggcgg cgctgctctg gctggtcgtg gaggaactgc ttgtcgaggc gcacgaaacg       720
     ccggagcggc catggatggc cgtgatgttc tttgccggat ttctgatctt gtacggcctg       780
     ggggtgatgg aatga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page