(data stored in ACNUC7421 zone)

EMBL: CP001658.PE331

CP001658.PE331       Location/Qualifiers
FT   CDS_pept        390774..391436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00324"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23352"
FT                   /protein_id="ACT23352.1"
FT                   /translation="MGRHELARDRRKSSAVLAAVLAPAAVFFATGGDVSTLAARADANP
FT                   VLGDDAPCCVQIVPVAPLAFSSQISGGEIGTGLAASQFASASRWRIVSRYLPVGVAPEQ
FT                   GLQVKTVLTARSISAAFPEIREIGGVRPDALRWHPNGLALDVMVPNPGTAEGIALGNEI
FT                   VAFVLKNATRFGMQDVIWRGAYYTPNGARTTGAGHYDHIHITTVGGGYPTGEELYIR"
     gtgggccgac atgaattagc tagggaccgg cgaaagtcgt cagcggtcct ggctgcggtc        60
     ctcgccccgg ccgccgtgtt cttcgccacg ggcggagatg tcagtacgct tgccgcccgc       120
     gccgatgcca acccggttct cggcgacgac gcgccctgtt gtgtgcagat cgtgccggtt       180
     gcaccgctgg ctttctcctc acagatatcc ggcggtgaaa tcgggacggg ccttgctgcc       240
     agccagttcg cttcggcatc gagatggcgc atcgtatctc ggtatttgcc ggtaggggtg       300
     gcacccgagc agggtctaca ggtcaagacc gtcttgacag cccgcagtat cagtgcggct       360
     ttccccgaaa ttcgcgaaat cggcggcgtt cggccggatg cgctgagatg gcatcccaat       420
     ggtttggcgc tcgacgtgat ggttcccaac cccggcaccg ccgagggcat agcgctgggc       480
     aacgagatcg tcgctttcgt actgaagaac gcgacccgat ttgggatgca agatgtgatt       540
     tggcgtggcg cctactacac gcccaacggc gcgcggacaa ccggggccgg ccactacgac       600
     cacatccaca tcacgaccgt gggcggcggg tatcccaccg gcgaggaact ctacatccgc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page