(data stored in ACNUC7421 zone)

EMBL: CP001658.PE334

CP001658.PE334       Location/Qualifiers
FT   CDS_pept        complement(393466..394137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23355"
FT                   /protein_id="ACT23355.1"
FT                   /translation="MNSCNRLPCAHEVLAVFAHPDDESFGLGAVLGDFTAQGTRLRGLC
FT                   FTHGEASTLGRTDRNLGEVRREELAAAAQVLGVDHVQLLAYPDNGLAQIPLNELTQRVV
FT                   DALAGADLLLVFDDNGVTGHPDHRRATEAALAAASTPGIPVLAWALPQPIADRLNAEFS
FT                   ASFGGRGHGHLDIMIEVDRSRQLAAIGCHFTQSADNPVLWRRLELLGDREYLRWLRRSV
FT                   P"
     atgaacagct gcaaccgtct cccctgcgca cacgaagtgc ttgctgtgtt cgcccatccg        60
     gacgacgagt ccttcgggct cggggcggta ttgggtgatt tcacggcgca gggaacgcgg       120
     ctgcgaggat tgtgcttcac ccacggcgag gcctccacac tcggccggac cgaccgaaac       180
     ctcggtgagg tgcgccggga ggaactcgcc gctgcggcac aggtcctggg tgtcgatcat       240
     gtgcaactac tcgcataccc ggataacggt ctagcgcaga tcccgctcaa cgagctgacg       300
     caacgcgtgg tggatgccct cgccggagca gacctgctac tcgtgttcga cgacaacggc       360
     gtaacaggcc accccgacca ccgtcgcgca accgaagctg cgctcgcggc ggcttcgaca       420
     cccggtatcc ccgtattggc ctgggcactg ccccaaccga tcgccgatcg gctcaacgcc       480
     gagttcagcg cctccttcgg ggggcgcggt cacggtcacc tcgacatcat gatcgaggtt       540
     gaccgcagcc gacagctagc cgctatcggc tgccatttca cccagtccgc cgacaacccc       600
     gtgctgtggc gtcgtctgga actgctcggt gaccgagagt acttgcgctg gctgcgccgg       660
     tcagtgccct aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page