(data stored in ACNUC7421 zone)

EMBL: CP001658.PE336

CP001658.PE336       Location/Qualifiers
FT   CDS_pept        394925..395149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23357"
FT                   /protein_id="ACT23357.1"
FT                   /translation="MGPKGSLRLVKRQPELLVAQHEHWQDTYRAHPVLYGTRPSEPGVY
FT                   AAEVFNADGVQRVLELAAGHGRDTLYFAG"
     gtggggccga agggaagtct acgtttggtg aagcggcagc cagaactgct cgttgcccag        60
     catgaacact ggcaggacac ctaccgagcg catccggtgc tgtacggaac ccgcccgtca       120
     gagccggggg tatatgccgc cgaggtgttc aatgccgacg gcgtgcagcg ggtgctggag       180
     ttggcggccg gtcatgggcg tgacaccctg tatttcgctg gctag                       225
//

If you have problems or comments...

PBIL Back to PBIL home page