(data stored in ACNUC7421 zone)

EMBL: CP001658.PE341

CP001658.PE341       Location/Qualifiers
FT   CDS_pept        complement(398233..398973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23362"
FT                   /protein_id="ACT23362.1"
FT                   /translation="MARSIPADRFSAIVAASARVFIAHGYQRTQVQDVADALALAKGTL
FT                   YGYAQGKAALFAAAVRYGDAQEALPLASELPVAAPVAGEIAAVVSARLAGEVTDMRLTH
FT                   ALRATLPPGATTGDARAELAGIVTDLYSRLARHRIALKLVDRCAPELPDLAEVWFGTGR
FT                   NAQVDAVQAYLVHRERAGLLILPGPAPMVARTIVELCALWAVHLHFDPSPEPWSIVQPG
FT                   VIDDDAIAATLAEFVVRATTASSD"
     atggcccgca gcattcccgc ggaccggttt tccgcgattg tcgccgcgtc ggcgcgggtg        60
     ttcatcgccc acggttacca gcgcacccag gtgcaggacg tggccgacgc actcgccctg       120
     gccaaaggca cgctgtatgg ctacgcccag ggcaaggctg cgctgttcgc ggcggcggtg       180
     cgctacggcg acgctcagga agcccttccg ctggcatccg aactgccggt ggccgctccc       240
     gttgcgggcg agatcgcagc tgtggtgtcg gcccgactgg ctggcgaggt caccgacatg       300
     cggctcacgc acgcgttgcg agcgactttg ccgccgggtg cgacgactgg agacgcgcga       360
     gcagaactcg ccggtatcgt caccgacctc tacagccgcc tggcccggca ccggatcgcg       420
     ctcaaactgg tcgaccgctg tgcccccgag ctacccgacc tcgccgaggt ttggttcggc       480
     accggccgga acgcccaagt cgatgcggtc caggcatacc tagtgcaccg cgagcgcgcc       540
     ggccttctga tcctgcccgg gccggcaccg atggtggccc ggaccatcgt cgagttgtgc       600
     gcgttgtggg cggtgcatct tcacttcgac ccgtcaccgg agccttggtc gatcgtgcaa       660
     cctggcgtga tcgatgacga tgcgatcgct gcgaccctcg ccgagtttgt cgttcgggcc       720
     accacagctt cttcggacta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page