(data stored in ACNUC7421 zone)

EMBL: CP001658.PE351

CP001658.PE351       Location/Qualifiers
FT   CDS_pept        411520..412059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23372"
FT                   /protein_id="ACT23372.1"
FT                   /translation="MANSLLDFVISLVRDPEAAARYAANPERSIAEAHLTDVTRADVNS
FT                   LIPVVSDSLSMSEPIGAAGGAHAGDRGNVWASGAATAALDAFAPHADAGVVQQHGAVGS
FT                   VLNQPTPPGPGVTPTDPRPFRAGPHETSALLTSAEIPDTTSEDGGLPTDHPAVWNHPVV
FT                   DPHTVEPDHHGYDIHG"
     gtggcaaact cgttgctcga ctttgtcatc tcgcttgtgc gcgacccgga agcggccgca        60
     cgttacgccg cgaaccccga gcggtcgatt gccgaagctc accttaccga cgtgaccaga       120
     gcggatgtga acagcctgat cccggtggtg tcggattcgt tgtcgatgtc cgaacccatc       180
     ggagccgctg gcggggcaca cgctggcgat cgtggcaacg tttgggcgag cggcgcggcc       240
     acggctgcgc ttgatgcgtt cgccccacac gccgatgcgg gtgttgtcca acagcacggt       300
     gcggtcggca gcgttctcaa ccagccgacc ccacccggac cgggcgtgac acccaccgat       360
     ccgcgcccct tccgagccgg tccacatgag acgtcggcgc tgctcacgag cgctgaaata       420
     cccgacacga ccagcgagga cgggggattg ccgacagacc atccggctgt ctggaaccac       480
     ccggtcgttg acccacatac cgtcgagccc gatcatcacg gctacgacat ccacggataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page