(data stored in ACNUC7421 zone)

EMBL: CP001658.PE354

CP001658.PE354       Location/Qualifiers
FT   CDS_pept        415643..417124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00347"
FT                   /product="isoniazid inductible protein iniC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23375"
FT                   /protein_id="ACT23375.1"
FT                   /translation="MSTSDRVRAILHATIQAYRGAPAYRQRGDVFCQLDRIGARLAEPL
FT                   RIALAGTLKAGKSTLVNALVGDDIAPTDATEATRIVTWFRHGPTPRVTANHRGGRRANV
FT                   PITRRGGLSFDLRRINPAELIDLEVEWPAEELIDATIVDTPGTSSLACDASERTLRLLV
FT                   PADGVPRVDAVVFLLRTLNAADVALLKQIGGLVGGSVGALGIIGVASRADEIGAGRIDA
FT                   MLSANDVAKRFTRELNQMGICQAVVPVSGLLALTARTLRQTEFIALRKLAGAERTELNR
FT                   ALLSVDRFVRRDSPLPVDAGIRAQLLERFGMFGIRMSIAVLAAGVTDSTGLAAELLERS
FT                   GLVALRNVIDQQFAQRSDMLKAHTALVSLRRFVQTHPVPATPYVIADIDPLLADTHAFE
FT                   ELRMLSLLPSRATTLNDDEIASLRRIIGGSGTSAAARLGLDPANSREAPRAALAAAQHW
FT                   RRRAAHPLNDPFTTRACRAAVRSAEAMVAEFSARR"
     gtgagcacca gcgaccgggt ccgcgcgatt ctgcacgcaa ccatccaggc ctaccggggt        60
     gcgccggcct atcgtcagcg tggcgacgtt ttttgccagc tggaccgcat cggtgcgcgc       120
     ctagccgaac cgctgcgcat cgcgttggct ggcacactca aggccggaaa atccactctc       180
     gtcaacgccc ttgtcggcga cgacatcgct ccgaccgatg ccaccgaggc cacccggatt       240
     gtgacctggt tccggcacgg tccgacaccg cgggtcaccg ccaaccatcg cggcggtcga       300
     cgcgccaacg tgccgatcac ccgtcggggc gggctgagtt tcgacctgcg caggatcaac       360
     ccggccgagc tgatcgacct ggaagtcgag tggccagccg aggaactcat cgacgccacc       420
     attgttgaca ccccgggaac gtcgtcgttg gcatgcgatg cctccgagcg cacgttgcgg       480
     ctgctggtcc ccgccgacgg ggtgcctcgg gtggatgcgg tggtgttcct gttgcgcacc       540
     ctgaacgccg ctgacgtcgc gctgctcaaa cagatcggtg ggctggtcgg cgggtcggtg       600
     ggagccctgg gcatcatcgg ggtggcgtct cgcgcggatg agatcggcgc gggccgcatc       660
     gacgcgatgc tctcggccaa cgacgtggcc aagcggttca cccgcgaact gaaccagatg       720
     ggcatttgcc aggcggtggt gccggtatcc ggacttcttg cgctgaccgc gcgcacactg       780
     cgccagaccg agttcatcgc gctgcgcaag ctggccggtg ccgagcgcac cgagctcaat       840
     agggccctgc tgagcgtgga ccgttttgtg cgccgggaca gtccgctacc ggtggacgcg       900
     ggcatccgtg cgcaattgct cgagcggttc ggcatgttcg gcatccggat gtcgattgcc       960
     gtgctggcgg ccggcgtgac cgattcgacc gggctggccg ccgaactgct ggagcgcagc      1020
     gggctggtgg cgctgcgcaa tgtgatagac cagcagttcg cgcagcgctc cgacatgctt      1080
     aaggcgcata ccgccttggt ctccttgcgc cgattcgtgc agacgcatcc ggtgccggcg      1140
     accccgtacg tcattgccga catcgacccg ttgctagccg acacccacgc cttcgaagaa      1200
     ctccgaatgc taagcctttt gccttcgcgg gcaacgacat tgaacgacga cgaaatcgcg      1260
     tcgctgcgcc gcatcatcgg cgggtcgggc accagtgccg ccgctcggct gggcctggat      1320
     cccgcgaatt ctcgcgaggc cccgcgcgcc gcgctggccg cagcgcaaca ctggcgtcgc      1380
     cgtgcggcgc atccactcaa cgatccgttc actaccaggg cctgtcgcgc ggcggtgcgc      1440
     agcgccgagg cgatggtggc ggagttctct gctcgccgct ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page