(data stored in ACNUC7421 zone)

EMBL: CP001658.PE36

CP001658.PE36        Location/Qualifiers
FT   CDS_pept        complement(39159..39932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23057"
FT                   /protein_id="ACT23057.1"
FT                   /translation="MADPGPFVADLRAESDDLDALVAHLPADRWADPTPAPGWTIAHQI
FT                   GHLLWTDRVALTAVTDEAGFAELMTAAAANPAGFVDDAATELAAVSPAELLTDWRVTRG
FT                   RLHEELLAVPDGRKLAWFGPPMSAASMATARLMETWAHGLDVADALGVIRPATQRLRSI
FT                   AHLGVRTRDYAFIVNNLTPPAEPFLVELRGPSGDTWSWGPSDAAQRVTGSAEDFCFLVT
FT                   QRRALSTLDVNAVGEDAQRWLTIAQAFAGPPGRGR"
     atggcggatc ctgggccgtt cgtggcagac ctgcgtgccg aaagcgacga cctcgacgcg        60
     ctggtggcgc atctgccagc ggatcgctgg gccgatccga cacctgcgcc gggttggacc       120
     atcgcacacc agatcggcca cctgctgtgg accgatcgag tggcgctgac ggcggtcacc       180
     gacgaggccg ggttcgccga gctgatgacc gccgccgcgg ccaatccggc cggtttcgtc       240
     gacgacgccg cgacagaact ggcggccgtt tcacctgccg aactgctcac agactggcgg       300
     gtcactcggg ggcggctgca cgaggaactg ctggcggttc ccgatggccg caaattggcc       360
     tggttcgggc caccgatgag cgcggcgtcg atggcaacag cgcggttgat ggagacctgg       420
     gcacatggac tggacgtcgc cgacgccctg ggcgtcatcc ggcccgccac ccagcgactg       480
     cggtctattg cgcatctcgg tgtccgcacc cgcgactacg cgttcatcgt caacaaccta       540
     acccctccgg ccgagccgtt cctggtcgag ctgcggggac cgagcggcga cacttggtct       600
     tgggggccat ccgatgcggc ccagcgggtc accgggtccg ccgaggactt ctgcttcctg       660
     gtcacccagc ggcgcgcgct gagcactctt gacgtcaacg cagtagggga ggacgcacaa       720
     cgctggctga cgatcgccca agctttcgcc gggccacccg gccgcggtcg atga             774
//

If you have problems or comments...

PBIL Back to PBIL home page