(data stored in ACNUC7421 zone)

EMBL: CP001658.PE360

CP001658.PE360       Location/Qualifiers
FT   CDS_pept        421835..422494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23381"
FT                   /protein_id="ACT23381.1"
FT                   /translation="MPELETPDDPESIYLARLEDVGEHRPTFTGDIYRLGDGRMVMILQ
FT                   HPCALRHGVDLHPRLLVAPVRPDSLRSNWARAPFGTMPLPKLIDGQDHSADFINLELID
FT                   SPTLPTCERIAVLSQSGVNLVMQRWVYHSTRLAVPTHTYSDSTVGPFDEADLIEEWVTD
FT                   RVDDGADPQAAEHECASWLDERISGRTRRALLSDRQHASSIRREARSHRKSVKLAD"
     gtgccagagc tggagacgcc cgacgaccca gagtcgatat accttgcccg cctcgaggat        60
     gtcggagaac acagaccgac gttcacgggc gacatctacc gactcggcga tggtcgcatg       120
     gtgatgatcc tccagcaccc atgcgcgctg cggcacggcg ttgacctcca tccgcgactg       180
     ctggtcgctc ccgtaagacc cgactcgctt cgttccaact gggctagagc cccgttcggc       240
     acgatgccgc ttccgaagct catcgacggt caggatcact cggcggactt catcaatctt       300
     gaactcatcg attcaccaac gcttccgacc tgtgagcgga tcgcggtgct cagccagtca       360
     ggcgtcaact tggtcatgca acggtgggtg taccacagca cccggctcgc cgtgcccacg       420
     cacacctact ccgacagcac cgttggcccg ttcgatgagg cagacctgat cgaggagtgg       480
     gtgacggatc gcgtcgacga tggggccgac ccgcaggcgg ccgaacacga atgcgcctcc       540
     tggctcgatg aaagaatcag cggccgcact cggcgagcgc tgctcagcga ccgtcagcac       600
     gccagttcaa tacggcgaga agcgcgttct catcgaaagt cggtcaagct ggcggactga       660
//

If you have problems or comments...

PBIL Back to PBIL home page