(data stored in ACNUC7421 zone)

EMBL: CP001658.PE364

CP001658.PE364       Location/Qualifiers
FT   CDS_pept        426525..426905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00357"
FT                   /product="merR-family heat shock protein transcriptional
FT                   repressor hspR"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23385"
FT                   /protein_id="ACT23385.1"
FT                   /translation="MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSG
FT                   GGRRYSLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELAVLRA
FT                   NQRREVAVVPKSTALVVWKPRR"
     atggcgaaga acccaaagga cggggaatcc cggacgtttt tgatctcggt agccgccgag        60
     ctagccggca tgcatgcaca gaccctgcgt acctacgatc gtcttgggtt ggtcagcccg       120
     cggcgcacct ccggtggcgg gcgccgctat tccctgcatg acgtcgagtt gctgcgccag       180
     gtgcagcacc tctcgcagga cgagggggtc aacttggccg gcatcaagcg cattattgaa       240
     ctgaccagtc aggtcgaggc gctgcagtcc aggttgcaag agatggctga ggagttggcg       300
     gtgttgcgtg ccaaccagcg ccgcgaggtc gcggtggtgc cgaagagcac cgccctggtc       360
     gtctggaaac cgcgccggtg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page