(data stored in ACNUC7421 zone)

EMBL: CP001658.PE365

CP001658.PE365       Location/Qualifiers
FT   CDS_pept        complement(427081..427632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00358"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23386"
FT                   /protein_id="ACT23386.1"
FT                   /translation="MSVCVIYIPFKGCVKHVSVTIPITTEHLGPYEIDASTINPDQPID
FT                   TAFTQTLDFAGSGTVGAFPFGFGWQQSPGFFNSTTTPSSGFFNSGAGGASGFLNDAAAA
FT                   VSGLGNVFTETSGFFNAGGVGNSGFQNFGNLLSGWANLGNTVSGFYNTSMLDLATQALI
FT                   SGFGNHGARLSGILNNGSGP"
     gtgtcggtct gcgtgatcta catccctttc aaggggtgtg taaagcatgt ctcggtcacc        60
     atacccatca ccaccgaaca tctcggcccc tacgaaatcg atgccagcac gatcaacccc       120
     gaccagccca tcgacacggc tttcacccaa accctcgatt tcgccggcag cggcaccgtg       180
     ggcgcgttcc ccttcggctt cggctggcag cagagcccgg gattcttcaa ctcgaccaca       240
     accccgtcgt cgggcttctt caactccggc gccggtggcg catcgggctt cctcaacgac       300
     gccgcagccg ccgtgtcggg cctgggaaac gtcttcaccg agacttcggg cttcttcaat       360
     gctggcggcg tagggaattc gggcttccaa aacttcggca acctgctgtc gggctgggcg       420
     aacctaggca ataccgtctc cggtttctac aacacgagca tgctggacct cgcgacccaa       480
     gcccttatct ccggcttcgg caaccacgga gcccgactct ccggcatcct caacaacggt       540
     agcggaccct aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page