(data stored in ACNUC7421 zone)

EMBL: CP001658.PE366

CP001658.PE366       Location/Qualifiers
FT   CDS_pept        complement(427715..437542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00359"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23387"
FT                   /protein_id="ACT23387.1"
FT                   /translation="MSFAVLPPEINSARLYVGAGLAPMLDAAAAWDGLADELGSAAASF
FT                   SAVTAGLAGSSWLGAASTAMTGAAAPYLGWLSAAAAQAQQAATQTRLAAAAFEAALAAT
FT                   VHPAIISANRALFVSLVVSNLLGQNAPAIAATEAAYEQMWAQDVAAMFGYHAGASAAVS
FT                   ALTPFGQALPTVAGGGALVSAAAAQVTTRVFRNLGLANVGEGNVGNGNVGNFNLGSANI
FT                   GNGNIGSGNIGSSNIGFGNVGPGLTAALNNIGFGNTGSNNIGFGNTGSNNIGFGNTGDG
FT                   NRGIGLTGSGLLGFGGLNSGTGNIGLFNSGTGNVGIGNSGTGNWGIGNSGNSYNTGFGN
FT                   SGDANTGFFNSGIANTGVGNAGNYNTGSYNPGNSNTGGFNMGQYNTGYLNSGNYNTGLA
FT                   NSGNVNTGAFITGNFNNGFLWRGDHQGLIFGSPGFFNSTSAPSSGFFNSGAGSASGFLN
FT                   SGANNSGFFNSSSGAIGNSGLANAGVLVSGVINSGNTVSGLFNMSLVAITTPALISGFF
FT                   NTGSNMSGFFGGPPVFNLGLANRGVVNILGNANIGNYNILGSGNVGDFNILGSGNLGSQ
FT                   NILGSGNVGSFNIGSGNIGVFNVGSGSLGNYNIGSGNLGIYNIGFGNVGDYNVGFGNAG
FT                   DFNQGFANTGNNNIGFANTGNNNIGIGLSGDNQQGFNIASGWNSGTGNSGLFNSGTNNV
FT                   GIFNAGTGNVGIANSGTGNWGIGNPGTDNTGILNAGSYNTGILNAGDFNTGFYNTGSYN
FT                   TGGFNVGNTNTGNFNVGDTNTGSYNPGDTNTGFFNPGNVNTGAFDTGDFNNGFLVAGDN
FT                   QGQIAIDLSVTTPFIPINEQMVIDVHNVMTFGGNMITVTEASTVFPQTFYLSGLFFFGP
FT                   VNLSASTLTVPTITLTIGGPTVTVPISIVGALESRTITFLKIDPAPGIGNSTTNPSSGF
FT                   FNSGTGGTSGFQNVGGGSSGVWNSGLSSAIGNSGFQNLGSLQSGWANLGNSVSGFFNTS
FT                   TVNLSTPANVSGLNNIGTNLSGVFRGPTGTIFNAGLANLGQLNIGSANLGDFNLGSGNV
FT                   GSFNVFSGNQGSYNIGPANLGNYNIGFANLGNYNIGFGNAGDFNQGFANTGNNNIGFAN
FT                   TGNNNIGIGLSGDNQQGFNFAGGWNSGTANIGLFNSGTNNVGIGNSGTGNWGIGNSGSG
FT                   NTGIGNTGSTNTGFFNTGIVNTGVANAGSYNTGWYNTGDTNTGIANLGDFNTGFYNTGN
FT                   FSTGFANQGDIATGAFITGDMGNGAFWRGDQQGLFSAGYRVHVPEIPAHVTVEVPVNIP
FT                   ITASFTNTVYSGITLEQINFGFTIDIAGIPLLAGAISKAVLPPITGTGPAITVNIGDPG
FT                   GSTAIRIPATASVGPFDVTFVNIAATTGFFNATTDPSSGFFNGGPGTVSGIANIGANIS
FT                   GFQNVANSATSGFNNYGSLQSGLANLGDTVSGVFNTGIGAPANVSGMFNIGSNLAGFFH
FT                   DQATGMSMFNLGLGNIGQFNVGFSNVGDSNAGLANIGSFNLGSGNLGSFNVFGGNQGSY
FT                   NIGPANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANTGNNNIGFANTGNNNIGIGLSGD
FT                   NQQGFNFAGGWNSGSGNSGLFNSGTNNIGLFNSGTGNIGIGNSGTGNWGIANTGDTNTG
FT                   IFNTGDVNTGLLNAGNVNTGIFNTGHYNTGSFNAGSFNTAGFNPGSYNTGYLNTGSYNT
FT                   GLANSGDVNTGGFITGNYSNGFWWRGDYQGLAGISQTITVPDTAVPVKLHVPIFLDIPV
FT                   TGTLGTFTVHGFRFPEITGDIFLIGIPFNAATLDAFSFPNISIVLPNIGINLGSGPDPL
FT                   IDIAGTGGLLPIKIPLIDIPAAPGFGNSTTTPSSGFFNAGTGTVSGVGNVGSNSSGFFN
FT                   LTSGSSGISGVQNFGELISGGFNFGNTVSGLVNASTLGLSMPANLSGGGNVGATVAGFV
FT                   NNTQILNLGFGNVGSGNVGHGNIGDSNVGLGNLGNANVGHGNIGSFNVFSGNRGSYNIG
FT                   PANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANSGSNNIGFANTGNNNIGIGLSGHNQQ
FT                   GFGSWNSGTANTGLFNSGTNNIGLFNSGTGNIGIGNSGIGNTGIGNPGVGNTGLGNSGT
FT                   GNWGLWNPGTGNMGVANVGTYNTGGYNVGSTNTGIANVGIANTGSYNTGSTNTGSFNDG
FT                   DFNTGFYNTGDYNTGFYNTGDVNTGAFIGGNFSNGAFWQSDHQGQWGAHYAITVPQIPL
FT                   LNFSLNIPVNIPIHLDFGTLAVNGFQIPAITLRALGVTHFSVGPIIVPRIAGTLPVIDI
FT                   NIGDPGGSSSIPITITSGAGPVVIPLLDIPPAPGFGNSTTGPSSGFFNSGTGSSSGFGN
FT                   VGANNSGFWNTAFAGIGNSGLQNFGSLQSGWANLGNTVSGFYNTSAADFATPANLSGLS
FT                   NVGADLTGVLRGPNGSTFNAGLANLGQFNVGSANLGSANLGSANLGNSNVGFGNIGNAN
FT                   IGGANIGDFNVGIANTGPGLTAAVNNIGIGNTGNYNIGVGNTGNYNIGFGNTGNNNIGI
FT                   GLSGDNQIGFGPLNAGIANMGLFNLGDNNFGMANAGNFNQGIANTGNNNIGLFNTGNNN
FT                   VGIGLTGDGLSGFSSLNSGAGNTGFFNSGTANTGLFNSGTGNTGLFNSGTGNVGIGNMG
FT                   TGGFGVGLSGDSQVGIGGTNSGSFNIGLFNSGTGNVGIGNSGTGNVGIGNTGTGNTGIG
FT                   NSGNYNTGLLNAGLVNTGIANPGNHNTGLFNIGTFNTGIANPGHYNTGSYNTGSYNTGM
FT                   ANAGDYGTGAFITGSMNNGLLWRADRQGLLAANYTITIERPAAFLNVDIPVNIPITGDI
FT                   TNVSIPAITFPRIDASGSVDIGILSGTVLAPVGPITLHGGDASAPLDTPIEIDFGPSPA
FT                   INLNIGKPDGSTVINIVGGAGAGPISIPIIDLRPAPGFFNATTGPSSGFLNWGAGSASG
FT                   LLNFGNNSGLYNFATSSMGNSGFQNYGSLQSGWANLGNSISGIYNTGLGAPANVSGLLN
FT                   IGTNLAGWLQNGPTETTFSVGLANLGFWNLGSANIGNYNLGSANIGVYNLGSANIGDFN
FT                   LGSANIGDFNLGSANIGSSNIGFGNVGPGLTAAIGNIGFGNTGNGNIGIGLTGDTMTGF
FT                   GGWNSGTGNIGLFNSGTGNIGFGNSGTGNWGIGNSGDYNTGIGNTGSTNSGFFNTGLVN
FT                   TGIGNSGDYNTGLFNAGNTNTGSFNPGDYNTGGFNPGNYNTGYFNPGNSNTGIANSGDV
FT                   NTGAFNSGNYSNGFFWRGDYQGLGGFAYQSAVSEIPWSYDRFQH"
     atgagcttcg cggtgctgcc cccggagatc aattcggcgc gcctgtacgt gggtgccggg        60
     ttggcgccga tgctggacgc ggcggccgct tgggatggac tggccgacga attgggttcg       120
     gccgcggcct cgttttcggc ggtgacggcg gggctggcag gttcctcgtg gctgggcgcg       180
     gcgtcgacgg cgatgacggg agcggccgcc ccctatctgg gctggttgag cgcggcggcg       240
     gcgcaggccc agcaggcggc cacccaaacc cggctggcgg cggccgcctt cgaggcagcc       300
     ctggcggcga cggtacatcc ggcgatcatc tcggccaacc gggcactgtt cgtgtcgctg       360
     gtggtctcga acctgctggg ccaaaacgcc ccggcgatcg cggccaccga ggccgcctac       420
     gagcagatgt gggcccagga cgtggcggcg atgtttggct accatgccgg ggcttcggcg       480
     gccgtctcgg cgttgacacc gttcggccag gcgctgccga ccgtggcggg cggcggtgcg       540
     ctggtcagcg cggccgcggc tcaggtgacc acgcgggtct tccgcaacct gggcttggcg       600
     aacgtcggcg agggcaacgt cggcaacggt aatgtcggga acttcaatct cggctcggcc       660
     aacatcggca acggcaacat cggcagcggc aacatcggca gctccaacat cgggtttggc       720
     aacgtgggtc ctgggttgac cgcagcgctg aacaacatcg gtttcggcaa caccggcagc       780
     aacaacatcg ggtttggcaa caccggcagc aacaacatcg gcttcggcaa taccggagac       840
     ggcaaccgag gtatcgggct cacgggtagc ggtttgttgg ggttcggcgg cctgaactcg       900
     ggcaccggca acatcggtct gttcaactcg ggcaccggaa acgtcggcat cggcaactcg       960
     ggtaccggga actggggcat tggcaactcg ggcaacagct acaacaccgg ttttggcaac      1020
     tccggcgacg ccaacacggg cttcttcaac tccggaatag ccaacaccgg cgtcggcaac      1080
     gccggcaact acaacaccgg tagctacaac ccgggcaaca gcaataccgg cggcttcaac      1140
     atgggccagt acaacacggg ctacctgaac agcggcaact acaacaccgg cttggcaaac      1200
     tccggcaatg tcaacaccgg cgccttcatt actggcaact tcaacaacgg cttcttgtgg      1260
     cgcggcgacc accaaggcct gattttcggg agccccggct tcttcaactc gaccagtgcg      1320
     ccgtcgtcgg gattcttcaa cagcggtgcc ggtagcgcgt ccggcttcct gaactccggt      1380
     gccaacaatt ctggcttctt caactcttcg tcgggggcca tcggtaactc cggcctggca      1440
     aacgcgggcg tgctggtatc gggcgtgatc aactcgggca acaccgtatc gggtttgttc      1500
     aacatgagcc tggtggccat cacaacgccg gccttgatct cgggcttctt caacaccgga      1560
     agcaacatgt cgggattttt cggtggccca ccggtcttca atctcggcct ggcaaaccgg      1620
     ggcgtcgtga acattctcgg caacgccaac atcggcaatt acaacattct cggcagcgga      1680
     aacgtcggtg acttcaacat ccttggcagc ggcaacctcg gcagccaaaa catcttgggc      1740
     agcggcaacg tcggcagctt caatatcggc agtggaaaca tcggagtatt caatgtcggt      1800
     tccggaagcc tgggaaacta caacatcgga tccggaaacc tcgggatcta caacatcggt      1860
     tttggaaacg tcggcgacta caacgtcggc ttcgggaacg cgggcgactt caaccaaggc      1920
     tttgccaaca ccggcaacaa caacatcggg ttcgccaaca ccggcaacaa caacatcggc      1980
     atcgggctgt ccggcgacaa ccagcagggc ttcaatattg ctagcggctg gaactcgggc      2040
     accggcaaca gcggcctgtt caattcgggc accaataacg ttggcatctt caacgcgggc      2100
     accggaaacg tcggcatcgc aaactcgggc accgggaact ggggtatcgg gaacccgggt      2160
     accgacaata ccggcatcct caatgctggc agctacaaca cgggcatcct caacgccggc      2220
     gacttcaaca cgggcttcta caacacgggc agctacaaca ccggcggctt caacgtcggt      2280
     aacaccaaca ccggcaactt caacgtgggt gacaccaata ccggcagcta taacccgggt      2340
     gacaccaaca ccggcttctt caatcccggc aacgtcaata ccggcgcttt cgacacgggc      2400
     gacttcaaca atggcttctt ggtggcgggc gataaccagg gccagattgc catcgatctc      2460
     tcggtcacca ctccattcat ccccataaac gagcagatgg tcattgacgt acacaacgta      2520
     atgaccttcg gcggcaacat gatcacggtc accgaggcct cgaccgtttt cccccaaacc      2580
     ttctatctga gcggtttgtt cttcttcggc ccggtcaatc tcagcgcatc cacgctgacc      2640
     gttccgacga tcaccctcac catcggcgga ccgacggtga ccgtccccat cagcattgtc      2700
     ggtgctctgg agagccgcac gattaccttc ctcaagatcg atccggcgcc gggcatcgga      2760
     aattcgacca ccaacccctc gtccggcttc ttcaactcgg gcaccggtgg cacatctggc      2820
     ttccaaaacg tcggcggcgg cagttcaggc gtctggaaca gtggtttgag cagcgcgata      2880
     gggaattcgg gtttccagaa cctcggctcg ctgcagtcag gctgggcgaa cctgggcaac      2940
     tccgtatcgg gctttttcaa caccagtacg gtgaacctct ccacgccggc caatgtctcg      3000
     ggcctgaaca acatcggcac caacctgtcc ggcgtgttcc gcggtccgac cgggacgatc      3060
     ttcaacgcgg gccttgccaa cctgggccag ttgaacatcg gcagcgcaaa tctcggcgac      3120
     ttcaacctgg gcagcggaaa cgtcggcagc ttcaacgtct tctccggaaa ccagggctca      3180
     tacaatatcg gtccggcgaa cctgggtaac tacaacatcg gtttcgcgaa cctgggtaac      3240
     tacaacatcg gcttcggcaa cgccggcgat ttcaaccaag gctttgccaa caccggcaac      3300
     aacaacatcg gatttgccaa caccggcaac aacaacatcg gcatcgggct gtccggcgac      3360
     aaccagcagg gcttcaattt tgctggcggc tggaactcag gcaccgcgaa catcggcttg      3420
     ttcaactccg gcaccaacaa cgtcggcatc ggcaactcgg gcaccggcaa ctggggtatc      3480
     ggcaactccg gcagcggcaa caccggcatc ggcaacaccg gcagcactaa cacgggcttc      3540
     ttcaacaccg gcatcgtcaa caccggtgtc gccaacgcgg gcagctacaa caccggctgg      3600
     tacaacaccg gcgacaccaa caccggcatc gccaacctgg gcgacttcaa cacgggcttc      3660
     tacaacaccg gcaatttcag tacgggcttt gccaaccagg gtgatatcgc caccggggct      3720
     ttcatcaccg gcgacatggg caacggcgcc ttctggcgcg gcgaccagca gggcctattc      3780
     agcgcgggct atcgggtcca tgttcccgaa atacccgcac acgtcaccgt ggaagttccc      3840
     gtcaacatcc ccatcaccgc cagcttcacc aacaccgtct acagcggcat aacgcttgag      3900
     caaatcaact tcggtttcac catcgacatc gcagggatcc ccctgctggc cggtgcaatc      3960
     agcaaggccg ttctcccgcc catcaccggg accggtcccg cgatcacggt caacatcggc      4020
     gaccctggcg gttcgaccgc gatcaggatc ccggccaccg caagcgtcgg tcccttcgat      4080
     gtcacgttcg tcaacattgc ggctaccacg ggctttttca acgccaccac cgatccgtcc      4140
     tcgggcttct tcaacggcgg ccccggaacc gtatcgggca tcgccaacat cggcgccaac      4200
     atttccggct tccagaacgt cgcgaactcc gcgacctcgg gcttcaacaa ctacggctcg      4260
     ctgcaatcgg gactggcgaa cctgggcgat accgtctcgg gcgtattcaa caccggcatc      4320
     ggggcaccgg ccaacgtctc gggcatgttc aacatcggca gcaacctcgc ggggttcttc      4380
     cacgaccagg cgaccgggat gtcgatgttc aacctcggcc tgggaaacat cggccaattc      4440
     aacgtcggct tctccaacgt aggcgacagc aacgccggct tggcgaacat cggcagcttc      4500
     aacctcggca gcggcaacct cggcagcttc aacgtcttcg gcggaaacca gggctcatac      4560
     aacatcggcc cggcgaacct gggtaactac aacatcggcc taggcaacct gggcagctac      4620
     aacttcggat tcggcaacgc cggcgacttc aacctgggct tcgccaacac cggcaacaac      4680
     aacatcgggt ttgccaacac cggcaacaac aacatcggta tcggcctgtc cggcgacaac      4740
     cagcagggct tcaattttgc cggtggctgg aactccggca gcggcaacag cggcctgttc      4800
     aactctggca ccaacaacat cggtttgttc aactcgggca ccggcaacat cggcatcggc      4860
     aactcgggca ccggaaactg gggcatcgcc aacaccggtg acaccaacac cggcatcttc      4920
     aacaccggcg acgtcaacac cggcttgctc aacgccggca acgtcaacac cggcatcttc      4980
     aacaccggcc attacaacac cggcagcttc aacgccggca gcttcaacac ggccggcttc      5040
     aacccgggta gctacaacac gggttatttg aacaccggca gctacaacac cggactggcc      5100
     aactcgggcg atgtcaacac cggcggcttc atcaccggca attacagcaa cgggttctgg      5160
     tggcggggcg attaccaagg cctggcgggg atcagccaaa cgatcaccgt gcccgacacc      5220
     gccgttccgg tgaaactgca cgtgccgatc ttcctcgata tcccggtcac cggcacactt      5280
     ggcacgttca ccgttcatgg cttcagattc ccggagatca ccggcgatat cttcttgatc      5340
     ggcataccgt tcaatgccgc cacactcgat gcattcagtt tcccgaacat ctcgattgtc      5400
     cttcccaata tcggcatcaa cctgggtagc gggccggacc cgctgatcga tatcgccggc      5460
     accggcggtc tattgccgat caagattcca ctcatcgata taccggcggc cccgggattc      5520
     gggaactcga cgaccacccc gtcgtcggga ttcttcaacg ccggtaccgg taccgtgtcg      5580
     ggcgttggca acgtgggcag caatagttcc ggcttcttca acctcacctc tggaagctcg      5640
     ggaatctcgg gcgtccagaa cttcggcgag ctgatctccg gcgggttcaa cttcggtaac      5700
     actgtctccg gccttgtcaa tgcgagcacg cttgggcttt cgatgccggc caatctctcc      5760
     ggcggaggga atgtcggtgc tacggtcgcc ggcttcgtca acaacaccca gatcctcaac      5820
     ctcgggtttg gcaacgtagg cagcgggaat gtcggccacg gcaatatcgg cgactccaac      5880
     gtcggcctcg gaaacctcgg caacgcgaac gtcggccatg gcaacatcgg cagcttcaac      5940
     gtcttctccg gaaaccgggg ctcatacaat atcggcccgg cgaacctggg taactacaac      6000
     atcggcctag gcaacctggg cagctacaac ttcggattcg gcaacgccgg cgatttcaac      6060
     ctgggcttcg ccaacagcgg cagcaacaac atcgggtttg ccaacaccgg caacaacaac      6120
     atcggtatcg ggctgtccgg ccacaatcaa caggggttcg gctcctggaa ctccggtacc      6180
     gccaacaccg gcctgttcaa ctcgggcacc aacaacatcg gtttgttcaa ctcgggcacc      6240
     ggaaacatcg gcattggcaa ctcgggcatc ggaaacaccg ggatcggcaa cccgggtgtc      6300
     ggcaacaccg gcttggggaa ctcgggcacc ggcaactggg gcctgtggaa cccaggcacc      6360
     ggcaatatgg gcgtcgccaa cgtgggcacc tacaacaccg gtggctacaa cgtgggcagc      6420
     accaacaccg gcatcgccaa cgtgggcatc gccaacacgg gcagctacaa caccggcagc      6480
     accaacaccg gcagcttcaa cgacggcgac ttcaataccg gcttctacaa caccggcgac      6540
     tacaacaccg gcttctacaa caccggcgac gtgaacaccg gcgccttcat cgggggcaac      6600
     ttcagcaacg gcgccttctg gcagagcgat caccaaggcc agtggggcgc acactacgca      6660
     atcactgttc cccagatccc gctactgaac tttagcctca acattccggt caacatcccc      6720
     atccatctcg acttcggtac ccttgccgtc aacggcttcc agattccggc tatcaccctc      6780
     cgcgccctcg gggtcaccca cttcagcgtc ggacccatca tcgttccgag gatcgccggc      6840
     accttaccgg tgatcgatat caacatcggc gaccccggcg gttcatcctc gatacccatc      6900
     acgatcacca gcggcgccgg cccggtcgtc atcccgctac tggacatccc gccggccccc      6960
     ggtttcggaa actcgaccac cggcccctca tcgggcttct tcaactccgg caccggcagc      7020
     tcgtctggat tcggaaacgt cggcgccaac aattcgggct tctggaacac cgctttcgcc      7080
     ggcataggaa actctggctt gcagaacttc ggctcgctgc aatccggctg ggcgaacttg      7140
     ggcaacaccg tctcgggctt ctacaacacc agtgcggcgg acttcgcgac gccggctaac      7200
     ctctcgggac tctccaacgt cggcgccgac ctgaccggcg tgctccgcgg cccgaacggg      7260
     tcgaccttca acgcgggcct ggcaaacctc ggccaattca acgtgggcag tgcaaacctc      7320
     ggcagtgcaa acctcggcag tgcaaacctc ggcaattcaa acgtcggctt cggcaacatt      7380
     ggcaacgcga acatcggcgg cgcaaacatc ggcgacttta acgtcgggat cgcaaacacc      7440
     ggtccggggc taacggcggc tgtcaacaac atcggtatcg gcaacaccgg caactacaac      7500
     atcggtgtcg gcaacaccgg taactacaac atcggcttcg gcaacaccgg caacaacaac      7560
     atcggcatcg gcctgtccgg cgacaaccag atcgggttcg gcccgctgaa cgccggcatc      7620
     gccaacatgg gcctgttcaa cctgggcgac aacaactttg gcatggccaa cgcgggcaac      7680
     ttcaaccagg gcattgccaa caccggcaac aacaacatcg gcttgttcaa caccggcaac      7740
     aacaacgtcg gcatcgggct gaccggcgac ggcttgtccg gcttcagctc cctgaactcc      7800
     ggcgccggca acaccggttt cttcaactcc ggcaccgcca acaccggctt gttcaactcc      7860
     ggcaccggca acaccggctt gttcaactcg ggcaccggca acgtcggcat cggcaacatg      7920
     ggcaccggcg gcttcggcgt cggcctatcc ggcgacagcc aggtgggcat cggcggcacc      7980
     aactcgggca gtttcaacat cggcttgttt aactcgggca ccggcaatgt cggcatcggc      8040
     aactcgggca ccggcaacgt cggcatcggc aacaccggca ccggcaacac cggcatcgga      8100
     aacagcggca actacaacac cggcttgctc aacgcgggcc tggtcaacac cggcatcgcc      8160
     aacccgggca accacaacac cggcctgttc aacatcggca ccttcaacac cggcatcgcc      8220
     aacccgggcc actacaacac cggctcctac aacaccggta gctacaacac cggcatggca      8280
     aacgccggag actacggcac cggcgcgttc atcaccggca gcatgaacaa cggcttgctc      8340
     tggcgcgccg accggcaggg cctgctggcg gccaactaca ccatcaccat cgagcgacct      8400
     gccgcgttcc tcaatgtcga catcccggtc aacatcccca tcaccggcga catcaccaat      8460
     gtctccatcc ccgccattac gttccccaga atcgacgcca gcggaagcgt cgacataggc      8520
     atcctcagtg gcaccgtctt ggccccggtc ggtccgatca ccctgcatgg cggggacgcg      8580
     tcggccccgc tggacacacc catcgaaatt gacttcggcc cctcgccggc gatcaacctc      8640
     aacatcggca agcccgacgg ctccaccgtg atcaacatcg tgggcggcgc cggcgccggc      8700
     ccgatcagca ttccgatcat cgacttgcgg ccagcgcccg gcttcttcaa cgccaccacc      8760
     ggcccgtcgt cgggcttcct caactggggt gctggcagcg catcgggctt gctgaacttc      8820
     ggcaacaact cgggcctcta caacttcgcc actagcagca tgggaaattc gggcttccaa      8880
     aactatgggt cgctgcagtc gggctgggcg aatttgggca acagcatctc gggcatctac      8940
     aacaccggct tgggagcacc ggcaaatgtc tcgggcttgc tcaacatcgg caccaacctg      9000
     gctgggtggt tgcagaacgg cccgaccgag acgaccttca gcgtgggctt ggccaacctc      9060
     gggttctgga atctgggtag cgcaaacatc ggcaactaca acctgggcag cgccaacatc      9120
     ggcgtctaca acctgggcag cgccaacatc ggcgacttca acctgggcag cgccaacatc      9180
     ggcgacttca acctgggcag cgccaacatc ggcagctcca acatcgggtt cggcaacgtc      9240
     ggtccggggc tgacggcggc catcggcaac atcggcttcg gcaacaccgg aaacggaaac      9300
     atcggcatcg ggctgaccgg cgacaccatg accgggttcg gcggctggaa ctcgggcacc      9360
     ggcaacatcg ggctattcaa ctccggcacc ggcaacatcg gcttcggcaa ctccggcacc      9420
     ggcaactggg gcatcggaaa ctccggtgac tacaacaccg gcatcggcaa caccggcagc      9480
     accaactccg gcttcttcaa caccggcctg gtcaacaccg gcattggcaa ctccggtgac      9540
     tacaacaccg gcctattcaa cgccgggaac accaacaccg gcagcttcaa ccccggcgac      9600
     tacaacaccg gcggcttcaa ccccggtaac tacaacaccg gctacttcaa cccgggcaac      9660
     tccaacaccg gcatcgccaa ctccggcgat gtcaacaccg gcgccttcaa ttcgggcaac      9720
     tacagcaacg gcttcttctg gcggggcgac taccagggcc taggcggttt cgcctaccag      9780
     agcgccgttt ccgaaatccc gtggagctac gacaggttcc aacattga                   9828
//

If you have problems or comments...

PBIL Back to PBIL home page