(data stored in ACNUC7421 zone)

EMBL: CP001658.PE367

CP001658.PE367       Location/Qualifiers
FT   CDS_pept        complement(437693..438337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23388"
FT                   /protein_id="ACT23388.1"
FT                   /translation="MTDASVHPDELDPEYHHHGGFPEYGPASPGAGFGQFVATMRRLQD
FT                   LAVAADPGDAVWDEAAERAAALVELLSPFEADEGKAPAGRTPGLPGMGSLLLPPWTVTR
FT                   YGTDGVEMRGSFSRFHVGGNSAVHGGVLPLLFDHMFGMISHAAGRPISRTAFLHVDYRR
FT                   ITPIDVPLIVRGRVTNTEGRKAFVCAELFDSDETLLAEGNGLMVRLLPGQP"
     gtgacagatg cgtcagtgca ccccgacgaa ctcgatcccg agtatcacca ccacggtgga        60
     tttccggagt acggtccggc cagtcccggt gcggggttcg gccagttcgt ggcgaccatg       120
     cgccggttgc aggacctggc ggtcgcggcg gaccccggcg acgccgtgtg ggacgaggcg       180
     gccgagcgcg ccgccgcgct cgtcgagttg ctgagcccat ttgaggccga cgaaggcaag       240
     gcgccggccg ggcggacccc cggcctgccc ggcatgggca gcctgctgct accgccatgg       300
     acggtgaccc ggtacggcac cgacggtgtt gagatgcggg ggtcgtttag ccggtttcac       360
     gtcgggggca actccgcggt gcacggcggc gtgttgccgc tgttgtttga tcacatgttc       420
     ggcatgatct cgcatgcggc gggacggccg atcagccgga ccgcctttct gcacgttgat       480
     taccgccgaa tcaccccgat tgatgtgccg ttgatcgtac gcggacgagt caccaatacc       540
     gagggccgaa aggcgtttgt gtgcgcggaa ctgtttgaca gcgacgagac gctgttggcc       600
     gaaggcaacg gcctgatggt gcggctactg cccggccagc cctag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page