(data stored in ACNUC7421 zone)

EMBL: CP001658.PE37

CP001658.PE37        Location/Qualifiers
FT   CDS_pept        complement(39980..41305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00036"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23058"
FT                   /protein_id="ACT23058.1"
FT                   /translation="MPRVEVGLVIHSRMHARAPVDVWRSVRSLPDFWRLLQVRVASQFG
FT                   DGLFQAGLAGALLFNPDRAADPMAIAGAFAVLFLPYSLLGPFAGALMDRWDRRWVLVGA
FT                   NTGRLALIAGVGTILAVGAGDVPLLVGALVANGLARFVASGLSAALPHVVPREQVVTMN
FT                   SVAIASGAVSAFLGANFMLLPRWLLGSGDEGASAIVFLVAIPVSIALLWSLRFGPRVLG
FT                   PDDTERAIHGSAVYAVVTGWLHGARTVVQLPTVAAGLSGLAAHRMVVGINSLLILLLVR
FT                   HVTARAVGGLGTALLFFAATGLGAFLANVLTPTAIRRWGRYATANGALAAAATIQVAAA
FT                   GLLVPVMVVCGFLLGVAGQVVKLCADSAMQMDVDDALRGHVFAVQDALFWVSYILSITV
FT                   AAALIPEHGHAPVFVLFGSAIYLAGLVVHTIVGRRGQPVIGR"
     gtgcccaggg tggaagtggg tttagtgatt cactcccgga tgcacgcacg cgcacccgtc        60
     gacgtttggc ggtcggtgcg cagcttgccc gacttctggc gtctgctgca ggtgcgggtt       120
     gcgagtcagt tcggcgacgg gttgtttcag gcggggctgg ccggagcgtt gctgttcaac       180
     ccggaccggg cggccgaccc gatggccatc gcgggggcct tcgcggtgct gtttctgccc       240
     tattcgctgc tggggccctt cgccggggcc ctaatggacc ggtgggatcg gcggtgggtg       300
     ctggttggcg ccaacaccgg ccggctagcc ctgatcgccg gggtcggcac gatactcgcg       360
     gtcggagccg gcgacgtgcc gctgttggtc ggagcgctgg tcgccaacgg cttggcacga       420
     ttcgtcgcct cgggactgtc ggcggcactg ccccacgtgg tgccgcgcga acaggtggtc       480
     acgatgaact cggtggccat cgcgtcgggg gcggtctccg cgttcctggg cgccaacttc       540
     atgctgttgc ctcgttggct gctcggcagc ggcgacgagg gggcctccgc gatcgtcttc       600
     ctggtggcga tccccgtatc gatcgcgttg ctttggtcgc tgcggttcgg cccgcgggta       660
     ctcggcccgg acgacaccga acgcgcgatc cacggatctg ctgtctacgc cgtggtcacc       720
     ggttggctac atggagcgcg caccgtggtg caacttccga ccgtcgctgc cggcctgtcc       780
     ggtttggcag cgcatcggat ggtggtcggt atcaactcac tgctgatctt gctcctggtc       840
     cgccacgtga ccgcccgggc cgttgggggg ttgggtaccg cactgctgtt cttcgcggcc       900
     accgggctgg gagccttcct ggccaacgtc ttgactccga ccgcgatccg gcgctgggga       960
     cgctacgcca cggcaaatgg cgcgttggct gcggccgcca ctatccaggt cgcggccgcc      1020
     gggctgctgg tcccggtgat ggtggtatgc ggcttccttt taggtgtggc cggccaggtg      1080
     gtcaagctgt gcgccgattc ggcgatgcag atggacgtcg acgacgcatt gcgcgggcac      1140
     gtgttcgccg tgcaggatgc actgttttgg gtctcataca tcctctcgat taccgtggcc      1200
     gcagccttga ttcccgagca cgggcacgcg cccgtatttg tgctgttcgg gtcggcgatc      1260
     tacctagccg ggctggtggt gcacaccatc gtcgggcgcc gcggccagcc tgtgatcggt      1320
     cgctag                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page