(data stored in ACNUC7421 zone)

EMBL: CP001658.PE372

CP001658.PE372       Location/Qualifiers
FT   CDS_pept        441685..442512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00365"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23393"
FT                   /protein_id="ACT23393.1"
FT                   /translation="MSNAPEPDRSAGESGSEPAGERSADPGEERTESYPLVPHDAETET
FT                   VVITTSDNDAAVTQPEAQRERRFTAPGFDAKETQVIVTAHEAATEVFQTNQAPTTPPRM
FT                   PTGMPPKTAVPQSIPPRTEATSVRQRTWGWALAVVVIVLALAAIAILGTVLLTRGKHSK
FT                   MSQEDQVRQAIQSLDIAIQTGDLTALRSLTCGSTRDGYVDYDERDWAETYRRVSAAKQY
FT                   PVIASIDQVVVNGAHAEANVTTFMAFDPQVRSTRSLDLQFRDDQWKICQSSSN"
     atgtccaacg cacccgagcc agaccgctca gccggtgaat ccgggagcga accggccggc        60
     gagcggtccg ccgatcctgg cgaggaacgc accgaaagct accccctggt gcctcacgac       120
     gccgaaaccg agaccgtggt gatcaccacc tccgacaacg atgccgcggt tacgcaaccg       180
     gaagcgcagc gcgaacgccg tttcaccgcg cccggcttcg acgccaagga gacccaggtg       240
     atcgtcacgg cccacgaggc agccaccgag gttttccaaa ccaaccaggc gccgaccacc       300
     ccgccgcgga tgccaaccgg aatgcccccg aaaactgctg tgccacaatc aatcccgcca       360
     cggacggagg cgacgtcagt ccggcaacgc acctggggct gggcgctggc ggtggtagtg       420
     atcgtgctgg cgttggcggc aatcgcgatc ctgggcaccg tgctgctgac ccgcggcaaa       480
     cattcgaaga tgtcgcagga agatcaggtg cggcaggcca tccagagctt ggacatcgcc       540
     atccagaccg gcgacctgac cgcgctgcgt tccctgactt gtggctccac ccgcgatggc       600
     tacgtggatt atgacgagcg tgattgggcc gaaacctatc gccgggtttc ggcggccaaa       660
     caatatccgg tcatcgccag catcgaccag gtcgtcgtca acggcgcgca cgccgaggcc       720
     aatgtcacca ctttcatggc gttcgatccc caggtccgct cgacccgcag cctcgaccta       780
     cagtttcgcg acgatcagtg gaagatctgc cagtcctcca gcaactga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page