(data stored in ACNUC7421 zone)

EMBL: CP001658.PE379

CP001658.PE379       Location/Qualifiers
FT   CDS_pept        complement(448177..449388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23400"
FT                   /protein_id="ACT23400.1"
FT                   /translation="MATPALLPGVDLAAFAAALAARLRDAGIPVSASGQASLVQALQQL
FT                   VPRTPAALYWGARLTLVSRVDELATFDAVFASLFGVFGSAEPDGANRPPPPIAGPRTPV
FT                   AGVGHRAKRRSCAAQAQNLPWDTRSLTMASAGQGGPSRTLPDVLPSRIVARADEPFDQF
FT                   DPDDLRLLGAWLEATMARWPRRRSMRFESSPHGKRIDLRATMNASRSTGWESVLLARIR
FT                   PRRRPRRVLLLCDVSRSMQPYAAIYLRLMRAAVLRRAGGHPEVFAFSTSLTRLTSVLSH
FT                   RSAEMALHRANARVTDRYGGTFIGRSVAALLAPPHGNALRGAVVIIASDGWDSDPPDVL
FT                   VHALTRVRRRAELLVWLNPRAAHPEFQPRAGSMAAALPYCDLFLPAHSLAGLHQLLLAL
FT                   AGAR"
     atggccaccc ctgcactgtt gccgggcgtc gacctcgcgg cgttcgcggc agcgctggca        60
     gcgcgccttc gcgacgccgg gataccggtg tccgccagcg gtcaagcgag tttggtgcag       120
     gcgttgcagc agttggtgcc gcgtacgccg gcggcgctgt attggggcgc gcggttgacc       180
     ctggtcagcc gtgtagacga actggccacg ttcgatgcgg tattcgcttc gctgttcggg       240
     gtatttggca gcgccgaacc cgacggtgcc aaccgcccac caccgcccat tgcaggcccg       300
     cgcacaccgg tggccggcgt cgggcaccgc gccaagcggc gatcttgtgc cgcccaagcc       360
     cagaatctgc cctgggatac tcgctcgctg acgatggcca gcgccggtca gggcggaccc       420
     agccgcacac tgcccgatgt cctgcccagc cgcattgtcg cccgggccga cgagccattc       480
     gaccagttcg atcccgacga tctgcgtctg ctcggcgcct ggctggaggc cacgatggcg       540
     cgctggccgc ggcggcgcag catgcgattc gagtccagcc cgcacggcaa gcgcatcgac       600
     ctgcgggcga cgatgaacgc gtcgcggtcg actggctggg agtcggtgct gttggcacgg       660
     atccggcccc gccgacgccc caggcgggtg ctcctgctct gcgatgtgag ccgctcgatg       720
     cagccctacg ccgccatcta tctgcgtctg atgcgggcgg cggtgctgcg ccgggcaggg       780
     ggccacccgg aggttttcgc gttttcgacg tcgctgactc gacttacctc ggtgctgtct       840
     catcgctcgg ccgagatggc gctacatcgg gccaacgcta gggtgaccga ccgctacggc       900
     ggtacgttca tcggccgtag tgtcgccgcc ctgctggccc cgccgcatgg caacgcgtta       960
     cgcggcgcgg tggtgatcat cgcctccgac ggctgggaca gcgatccgcc cgacgtgttg      1020
     gtgcacgcac tgaccagggt gcgtcgccgc gccgagttgc tggtctggct gaaccctcgc      1080
     gcggcacatc cggagttcca gccgcgtgcc ggttcgatgg cggcggcgct gccctattgc      1140
     gacctgttcc tgccggcgca ctcgctggcc ggcctgcacc agttgctgct ggcgctggcc      1200
     ggtgcccgct ag                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page