(data stored in ACNUC7421 zone)

EMBL: CP001658.PE382

CP001658.PE382       Location/Qualifiers
FT   CDS_pept        complement(450903..451496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23403"
FT                   /protein_id="ACT23403.1"
FT                   /translation="MTATQITGVVLAAGRSNRLGTPKQLLPYRDTTVLGATLDVARQAG
FT                   FDQLILTLGGAASAVRAAMALDGTDVVVVEDVERGCAASLRVALARVHPRATGIVLMLG
FT                   DQPQVAPATLRRIIDVGPATEIMVCRYADGVGHPFWFSRTVFGELARLHGDKGVWKLVH
FT                   SGRHPVRELAVDGCVPLDVDTWDDYRRLLESVPS"
     atgaccgcga cccagatcac cggtgtggta ctcgccgccg ggcgctccaa ccggttgggc        60
     acgcccaaac agctactgcc atatcgggat accacggtgc ttggggccac cctcgacgtt       120
     gcccggcaag ccggattcga ccagctgatc ctcaccctgg gcggtgcggc gtcggcggtg       180
     cgtgccgcga tggcgctgga cgggaccgac gtggtggtcg tcgaggatgt cgagcgcggg       240
     tgtgcggcat cgctgcgcgt cgcgttggca cgggtgcatc cgcgggccac cgggatcgtg       300
     ctgatgctgg gcgaccagcc tcaggtggcg ccggcgacac tgcggcggat catcgacgtc       360
     gggccggcca ccgagatcat ggtgtgccgc tacgccgacg gcgtcgggca tccattctgg       420
     tttagccgca ccgtgttcgg cgaactcgcg cgactgcacg gcgacaaggg tgtctggaag       480
     ctggtgcact ccggccgcca cccagtgcgc gaactcgccg tggacggctg cgtgccgctt       540
     gacgtggaca cctgggacga ctaccgacgg ctgctggaat cggtgccctc gtga             594
//

If you have problems or comments...

PBIL Back to PBIL home page