(data stored in ACNUC7421 zone)

EMBL: CP001658.PE383

CP001658.PE383       Location/Qualifiers
FT   CDS_pept        complement(451493..452248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23404"
FT                   /protein_id="ACT23404.1"
FT                   /translation="MSISDRAAQLVAARTPFVRATVVRAQQPTSARPGDEAILLADGTI
FT                   EGFVGGHCAQNSVRKAAMGVLQAGESVLLRVLPDGDVHFPEAPGACVVVNPCLAGGSLE
FT                   IFLTPQLPAPLIQIYGETPIADALIELCGLLGYDARRDTDPADTDALPTAIVIASHGGP
FT                   EAEIIRTALDNGVGYVGLVASTVRGASILDSLDLSDAERARVHTPVGLAIGAKTPAEIA
FT                   VSIAAELIATLRGGGPRGRKALADENGGA"
     atgtccatca gtgaccgggc cgcacagctg gtggccgcgc ggacaccgtt cgtgcgcgcg        60
     accgtggtgc gggcccagca gcccacgtcg gcccgcccgg gcgatgaggc aatcctgttg       120
     gcggacggca ccatcgaggg ctttgtcggc ggccactgcg cgcagaactc ggtccgcaag       180
     gcggcgatgg gcgtgttgca ggccggcgag agcgtgctgc tgcgcgtgct gcccgacggt       240
     gacgtgcact tcccggaagc tcccggggcg tgtgtggtgg tcaacccgtg cctggccggc       300
     ggatccctgg agatcttcct gaccccgcag ctgccggccc cgctgatcca gatttacggc       360
     gaaaccccga tcgccgacgc gttgatcgaa ctgtgcggcc tgttgggcta cgacgcgcgc       420
     cgcgacaccg atccggccga caccgacgcc ttgccaactg cgattgtgat cgccagccac       480
     ggcgggcccg aagccgaaat catccgcacg gcgctggata acggcgttgg gtatgtcggg       540
     ctggtggcca gcacggtacg cggcgcgtcc atcctggatt cgctggacct gtccgatgcc       600
     gagcgggccc gggtgcatac cccggtcgga ttggccatcg gcgccaaaac tccggcggag       660
     atcgcggtgt cgattgcggc ggaactgatc gccacgctgc gcggcggcgg ccccagaggc       720
     cggaaggcgt tggcggacga gaacggcggc gcatga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page