(data stored in ACNUC7421 zone)

EMBL: CP001658.PE4

CP001658.PE4         Location/Qualifiers
FT   CDS_pept        4536..5099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23025"
FT                   /protein_id="ACT23025.1"
FT                   /translation="MTGSVDRPDQNRGERSMKSPGLDLVRRTLDEARAAARARGQDAGR
FT                   GRVASVASGRVAGRRRSWSGPGPDIRDPQPLGKAARELAKKRGWSVRVAEGMVLGQWSA
FT                   VVGHQIAEHARPTALNDGVLSVIAESTAWATQLRIMQAQLLAKIAAAVGNDVVRSLKIT
FT                   GPAAPSWRKGPRHIAGRGPRDTYG"
     atgacgggtt ctgttgaccg gcccgaccag aatcgcggtg agcgatcaat gaagtcacca        60
     gggttggatt tggtcaggcg caccctggac gaagctcgtg ctgctgcccg cgcgcgcgga       120
     caagacgccg gtcgagggcg ggtcgcttcc gttgcgtcgg gtcgggtggc cggacggcga       180
     cgaagctggt cgggtccggg gcccgacatt cgtgatccac aaccgctggg taaggccgct       240
     cgtgagctgg caaagaaacg cggctggtcg gtgcgggtcg ccgagggtat ggtgctcggc       300
     cagtggtctg cggtggtcgg ccaccagatc gccgaacatg cacgcccgac tgcgctaaac       360
     gacggggtgt tgagcgtgat tgcggagtcg acggcgtggg cgacgcagtt gaggatcatg       420
     caggcccagc ttctggccaa gatcgccgca gcggttggca acgatgtggt gcgatcgcta       480
     aagatcaccg ggccggcggc accatcgtgg cgcaaggggc ctcgccatat tgccggtagg       540
     ggtccgcgcg acacctacgg ataa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page