(data stored in ACNUC7421 zone)

EMBL: CP001658.PE40

CP001658.PE40        Location/Qualifiers
FT   CDS_pept        complement(42536..43468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00039"
FT                   /product="secreted proline rich protein mtc28"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23061"
FT                   /protein_id="ACT23061.1"
FT                   /translation="MIQIARTWRVFAGGMATGFIGVVLVTAGKASADPLLPPPPIPAPV
FT                   SAPATVPPVQNLTALPGGSSNRFSPAPAPAPIASPIPVGAPGSTAVPPLPPPVTPAISG
FT                   TLRDHLREKGVKLEAQRPHGFKALDITLPMPPRWTQVPDPNVPDAFVVIADRLGNSVYT
FT                   SNAQLVVYRLIGDFDPAEAITHGYIDSQKLLAWQTTNASMANFDGFPSSIIEGTYREND
FT                   MTLNTSRRHVIATSGADKYLVSLSVTTALSQAVTDGPATDAIVNGFQVVAHAAPAQAPA
FT                   PAPGSAPVGLPGQAPGYPPAGTLTPVPPR"
     atgatccaga tcgcgcgcac ctggcgggtc ttcgcaggcg gcatggccac cggtttcatc        60
     ggcgtggtgc tggtcaccgc cgggaaggcc tcagcggatc ccctgctgcc accgccgcct       120
     atccctgccc cagtctcggc gccggcaaca gtcccgcccg tgcagaacct cacggcgctt       180
     ccgggcggga gcagcaacag gttctcaccg gcgccagcac ccgcaccgat cgcgtcgccg       240
     attccggtcg gagcacccgg gtccaccgct gtgcccccgc tgccgccgcc agtgactccc       300
     gcgatcagcg gcacacttcg ggaccacctc cgggagaagg gcgtcaagct ggaggcacag       360
     cgaccgcacg gattcaaggc gctcgacatc acactgccga tgccgccgcg ctggactcag       420
     gtgcccgacc ccaacgtgcc cgacgcgttc gtggtgatcg ccgaccggtt gggcaacagc       480
     gtctacacgt cgaatgcgca gctggtggtg tataggctga tcggtgactt cgatcccgct       540
     gaggccatca cacacggcta cattgacagc cagaaattgc tcgcatggca gaccacaaac       600
     gcctcgatgg ccaatttcga cggctttccg tcatcaatca tcgagggcac ctaccgcgaa       660
     aacgacatga ccctcaacac ctcccggcgc cacgtcatcg ccacctccgg agccgacaag       720
     tacctggttt cgctgtcggt gaccaccgcg ctgtcgcagg cggtcaccga cgggccggcc       780
     accgatgcga ttgtcaacgg attccaagtg gttgcgcatg cggcgcccgc tcaggcgcct       840
     gccccggcac ccggttcggc accggtggga ctacccgggc aggcgcctgg gtatccgccc       900
     gcgggcaccc tgacaccagt cccgccgcgc tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page