(data stored in ACNUC7421 zone)

EMBL: CP001658.PE401

CP001658.PE401       Location/Qualifiers
FT   CDS_pept        complement(474381..475100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00394"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23422"
FT                   /protein_id="ACT23422.1"
FT                   /translation="MTEPRPVFAVVISAGLSAIPMVGGPLQTVFDAIEERTRHRAETTT
FT                   REICESVGGADTVLSRIDKNPELEPLLSQAIEAATRTSMEAKRRLLAQAAAAALEDDQK
FT                   VEPASLIVATLSQLEPVHIHALVRLAKAAKSSPDQDEIQRREVMRAASKVEPVPVLAAL
FT                   IQTGVAIATTTVWHGNGTGTPAEESGHILIHDVSDFGHRLLAYLRAADAGAELLILPSG
FT                   GSAPTGDHPTPHPSTSR"
     atgactgagc ccagacctgt cttcgctgtc gtgatcagcg ccggcctatc cgccatcccg        60
     atggtcggcg gcccgctaca aaccgtgttc gacgccatcg aggaacgcac ccggcaccgc       120
     gccgagacaa ccacgcgcga gatatgcgag agcgtcggcg gcgcggacac cgtgttgagc       180
     cgcattgaca aaaatcccga actcgagccg cttctcagcc aggcgatcga ggccgccact       240
     cgcaccagta tggaggccaa gcgccggctc ctcgcgcaag ctgccgccgc cgcgctcgag       300
     gatgaccaga aggtcgagcc ggcatcactc atcgtggcca cgctttccca acttgagccc       360
     gtgcatatcc atgcactcgt tcggctggcc aaagccgcca agtcctcacc ggaccaggac       420
     gagatccagc gacgcgaggt gatgagggcg gcgagtaagg tcgagcccgt gccggtgcta       480
     gcggccctca ttcaaaccgg cgtcgcgatc gcgacaacaa ccgtttggca cggcaacggc       540
     accgggactc cggcagaaga aagcggccac atccttatcc acgacgtcag cgacttcggc       600
     caccgcctgc tggcctatct cagggccgcc gacgcaggtg ccgagctcct catcctcccc       660
     tctggagggt ctgcgccaac cggcgaccac ccgacgccgc acccgtccac gtcgagatga       720
//

If you have problems or comments...

PBIL Back to PBIL home page