(data stored in ACNUC7421 zone)

EMBL: CP001658.PE402

CP001658.PE402       Location/Qualifiers
FT   CDS_pept        475199..475603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23423"
FT                   /protein_id="ACT23423.1"
FT                   /translation="MDWMPLGDYETFRHWSGKPRAWGPQESGWRAWFGGKIVDGLCEVL
FT                   DEHLAVRRRGVPAAIGCVPWLSSEAVAETLLALSAFCVVIDKGTSFPSRLRNPDKGFPN
FT                   VALLRLRDMAPSEHGSRCSSARGRLCLSMS"
     atggattgga tgccgctcgg cgactacgag actttccggc attggtcggg gaagccccgc        60
     gcatgggggc cgcaagagtc ggggtggcgc gcgtggttcg gcgggaagat agtcgatggg       120
     ctctgcgagg tactcgacga gcacctcgcg gtgcggcgtc gtggtgttcc agccgcgatc       180
     ggctgcgtgc cctggctgag tagcgaggcg gtcgccgaga cgctgctcgc attgagcgcc       240
     ttttgcgtgg tgatcgacaa gggaacctcg ttcccgtcgc gactgcgtaa ccctgacaaa       300
     gggtttccca acgtcgccct attgcggctt cgcgacatgg cgccctccga gcatggctca       360
     cgctgctcct cggcccgtgg tcgtctatgc ctgagcatga gctag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page