(data stored in ACNUC7421 zone)

EMBL: CP001658.PE403

CP001658.PE403       Location/Qualifiers
FT   CDS_pept        475585..476001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23424"
FT                   /protein_id="ACT23424.1"
FT                   /translation="MPEHELGPVRALGWLREDRKPLLNAKLLVLGHLALNVYDPDNGYG
FT                   EEVLDFEPRTVWWGSANWTVRAGSHLEVGFACDDPTLVEEATAFVADVIAFSEPIDTTC
FT                   AGPEPNLVQVEFDDAAMAEAMEEMAEPDDDGEDW"
     atgcctgagc atgagctagg tccggtgcgg gcgctcggct ggctacgaga ggaccgcaag        60
     ccgctgctga atgccaaatt gctcgtgctc ggtcatctgg ctttgaacgt ctacgacccc       120
     gataacggtt acggcgaaga ggtgttggac tttgagccgc ggacggtgtg gtggggatcg       180
     gccaattgga ccgtgcgggc cgggtcacac ttggaagttg gctttgcatg cgacgaccca       240
     accctcgtcg aagaagctac agcgtttgtc gctgacgtga tcgcgttctc cgaaccgatc       300
     gacacgacct gtgccggtcc cgaaccgaac ctcgtgcagg tggagttcga cgacgccgcg       360
     atggctgagg cgatggagga gatggccgag cccgatgatg acggggagga ttggtag          417
//

If you have problems or comments...

PBIL Back to PBIL home page