(data stored in ACNUC7421 zone)

EMBL: CP001658.PE404

CP001658.PE404       Location/Qualifiers
FT   CDS_pept        476075..476443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00397"
FT                   /product="13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23425"
FT                   /protein_id="ACT23425.1"
FT                   /translation="MLATFWGWRAQQLPDGTVIWTLPGDQTYVTTPGSALLFPALCTPT
FT                   GDPPRPDPARADRRGQRTAMMPRRASTRAQNRAHYIAAERHRNHQARRIAHVVTQTATT
FT                   APETNGPPPDPDDDPPPF"
     ttgctggcca ccttctgggg ctggcgcgcc cagcaactgc ccgacggcac cgtgatttgg        60
     acgctgccgg gtgaccagac ctatgtcacc accccgggca gcgcgctgct gttcccggcg       120
     ctgtgcaccc ccaccggtga cccacctcga cccgacccgg cccgcgccga ccgccgcggg       180
     cagcgcaccg cgatgatgcc gcgccgggcc agcacccgag cgcaaaaccg cgcccactac       240
     atcgccgccg aacgccaccg caaccaccaa gcccgccgga ttgcccacgt ggtcacccaa       300
     accgccacaa ccgcccccga gactaacggc ccaccacccg atcccgacga cgacccgccg       360
     cccttctaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page