(data stored in ACNUC7421 zone)

EMBL: CP001658.PE409

CP001658.PE409       Location/Qualifiers
FT   CDS_pept        480048..480419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00402"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23430"
FT                   /protein_id="ACT23430.1"
FT                   /translation="MRPRRALAGLAADVVAVLVFCAVGRRSHAEGLSVTGLAATAWPFL
FT                   TGTGIGWVLARGWRRPTALAPTGVIVWLCTIVVGMVLRKVSSAGVAASFVVVASAVTAV
FT                   LLLGWRAAVALMAPHRADG"
     atgcgaccac ggcgcgcgct ggcggggctg gccgccgacg tcgtcgccgt gctggtgttc        60
     tgcgcggtgg gacgtcgcag ccacgccgaa ggactgagcg tcaccggcct ggcggctacg       120
     gcatggccat ttctcaccgg cactggtatc ggttgggtgc tggctcgcgg ctggcggcgg       180
     ccgaccgccc tcgcccccac gggggtgatc gtgtggctgt gcaccatcgt ggtcggcatg       240
     gtgttacgca aggtcagttc ggcgggtgtg gccgcgagtt tcgtcgtggt cgcgtccgcg       300
     gtcaccgcgg tgctgctgct gggttggaga gccgccgttg cgctgatggc accgcaccgc       360
     gcggacggct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page