(data stored in ACNUC7421 zone)

EMBL: CP001658.PE418

CP001658.PE418       Location/Qualifiers
FT   CDS_pept        complement(495321..497573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00411"
FT                   /product="serine/threonine-protein kinase pknG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23439"
FT                   /protein_id="ACT23439.1"
FT                   /translation="MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDN
FT                   FPHPTLGPDTEPQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKR
FT                   FCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLG
FT                   WIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDR
FT                   HGDPVGYIVMEYVGGQSLKRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPEN
FT                   IMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL
FT                   DLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREV
FT                   VAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLV
FT                   DPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGD
FT                   VAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLAL
FT                   AATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRH
FT                   FTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLK
FT                   DNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF"
     atggccaaag cgtcagagac cgaacgttcg ggccccggca cccaaccggc ggacgcccag        60
     accgcgacgt ccgcgacggt tcgacccctg agcacccagg cggtgttccg ccccgatttc       120
     ggcgatgagg acaacttccc ccatccgacg ctcggcccgg acaccgagcc gcaagaccgg       180
     atggccacca ccagccgggt gcgcccgccg gtcagacggc tgggcggcgg cctggtggaa       240
     atcccgcggg cgcccgatat cgatccgctt gaggccctga tgaccaaccc ggtggtgccg       300
     gagtccaagc ggttctgctg gaactgtgga cgtcccgtcg gccggtccga ctcggagacc       360
     aagggagctt cagagggctg gtgtccctat tgcggcagcc cgtattcgtt cctgccgcag       420
     ctaaatcccg gggacatcgt cgccggccag tacgaggtca aaggctgcat cgcgcacggc       480
     ggactgggct ggatctacct cgctctcgac cgcaatgtca acggccgtcc ggtggtgctc       540
     aagggcctgg tgcattccgg tgatgccgaa gcgcaggcaa tggcgatggc cgaacgccag       600
     ttcctggccg aggtggtgca cccgtcgatc gtgcagatct tcaactttgt cgagcacacc       660
     gacaggcacg gggatccggt cggctacatc gtgatggaat acgtcggcgg gcaatcgctc       720
     aaacgcagca agggtcagaa actgcccgtc gcggaggcca tcgcctacct gctggagatc       780
     ctgccggcgc tgagctacct gcattccatc ggcttggtct acaacgacct gaagccggaa       840
     aacatcatgc tgaccgagga acagctcaag ctgatcgacc tgggcgcggt atcgcggatc       900
     aactcgttcg gctacctcta cgggacccca ggcttccagg cgcccgagat cgtgcggacc       960
     ggtccgacgg tggccaccga catctacacc gtgggacgca cgctcgcggc gctcacgctg      1020
     gacctgccca cccgcaatgg ccgttatgtg gatgggctac ccgaagacga cccggtgctg      1080
     aaaacctacg actcttacgg ccggttgctg cgcagggcca tcgaccccga tccgcggcaa      1140
     cggttcacca ccgccgaaga gatgtccgcg caattgacgg gcgtgttgcg ggaggtggtc      1200
     gcccaggaca ccggggtgcc gcggccaggg ctatcaacga tcttcagtcc cagtcggtcg      1260
     acatttggag tggacctgct ggtggcgcac accgacgtgt atctggacgg gcaggtgcac      1320
     gcggagaagc tgaccgccaa cgagatcgtg accgcgctgt cggtgccgct ggtcgatccg      1380
     accgacgtcg cagcttcggt cctgcaggcc acggtgctct cccagccggt gcagacccta      1440
     gactcgctgc gcgcggcccg ccacggtgcg ctggacgccg acggcgtcga cttctccgag      1500
     tcagtggagc tgccgctaat ggaagtccgc gcgctgctgg atctcggcga tgtggccaag      1560
     gccacccgaa aactcgacga tctggccgaa cgcgttggct ggcgatggcg attggtctgg      1620
     taccgggccg tcgccgagct gctcaccggc gactatgact cggccaccaa acatttcacc      1680
     gaggtgctgg atacctttcc cggcgagctg gcgcccaagc tcgccctggc cgccaccgcc      1740
     gaactagccg gcaacaccga cgaacacaag ttctatcaga cggtgtggag caccaacgac      1800
     ggcgtgatct cggcggcttt cggactggcc agagcccggt cggccgaagg tgatcgggtc      1860
     ggcgccgtgc gcacgctcga cgaggtaccg cccacttctc ggcatttcac cacggcacgg      1920
     ctgaccagcg cggtgactct gttgtccggc cggtcaacga gtgaagtcac cgaggaacag      1980
     atccgcgacg ccgcccgaag agtggaggcg ctgcccccga ccgaaccacg cgtgctgcag      2040
     atccgcgccc tggtgctggg tggcgcgctg gactggctga aggacaacaa ggccagcacc      2100
     aaccacatcc tcggtttccc gttcaccagt cacgggctgc ggctgggtgt cgaggcgtca      2160
     ctgcgcagcc tggcccgggt agctcccact caacggcatc gctacacgct ggtggacatg      2220
     gccaacaagg tccggcccac cagcacgttc taa                                   2253
//

If you have problems or comments...

PBIL Back to PBIL home page