(data stored in ACNUC7421 zone)

EMBL: CP001658.PE421

CP001658.PE421       Location/Qualifiers
FT   CDS_pept        499972..500625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00414"
FT                   /product="mutator protein mutT3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23442"
FT                   /protein_id="ACT23442.1"
FT                   /translation="MPSCPPAYSEQVRGDGDGWVVSDSGVAYWGRYGAAGLLLRAPRPD
FT                   GTPAVLLQHRALWSHQGGTWGLPGGARDSHETPEQTAVRESSEEAGLSAERLEVRATVV
FT                   TAEVCGVDDTHWTYTTVVADAGELLDTVPNRESAELRWVAENEVADLPLHPGFAASWQR
FT                   LRTAPATVPLARCDERRQRLPRTIQIEAGVFLWCTPGDADQAPSPLGRRISSLL"
     ttgcccagtt gcccgcctgc atattctgaa caggtgcggg gcgacggtga cggatgggtg        60
     gtgtccgaca gcggcgttgc gtactggggc cgctacggtg cggccggtct gttgcttcgg       120
     gctccgcggc cggacggcac ccccgcggtg ctgctgcagc accgcgcgct gtggagccat       180
     cagggcggca cctggggctt gccgggcggt gctcgagaca gccacgagac gccggaacag       240
     accgcggtcc gcgaatcgag cgaggaggcg ggcctgtccg ccgagcgact cgaggtgcgg       300
     gccacggtgg tcaccgccga ggtgtgcggg gtcgacgaca cgcactggac ctacaccacc       360
     gttgtcgccg atgccgggga gttgctggac accgtgccca accgggaaag cgccgaactg       420
     cgctgggtgg ccgagaacga ggtggccgac ttgccgttac atcccggatt cgccgccagt       480
     tggcaacgac tgcggaccgc tccggcgacc gtgccactgg cccggtgcga cgaacggcgg       540
     cagcggctgc cgcgcaccat tcagatcgag gccggggttt tcctctggtg tacgccgggc       600
     gacgcggatc aggcgccctc gccgctgggt aggcggatca gttcgctgct gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page