(data stored in ACNUC7421 zone)

EMBL: CP001658.PE429

CP001658.PE429       Location/Qualifiers
FT   CDS_pept        complement(506820..507230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00421"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23450"
FT                   /protein_id="ACT23450.1"
FT                   /translation="MRLHDASAAAPESRMHIARHGEAVNRRQMFIGITGLLLAVIGLMA
FT                   LWFPVYLDQYDAYGIKVTCGSGWRSNLTQALYADGNDNTQALVTRCDTALLVRRAWAIP
FT                   SVALGWLLVTGFLVMWVHNDQHQGQSYPGYRA"
     ttgcgcttgc atgacgcgag cgctgcggcg cccgaatccc gaatgcacat cgcaagacat        60
     ggagaagccg tgaatcgtcg ccagatgttc atcggaatta ctggcctgct gctggcggtc       120
     attggtctga tggcgctgtg gtttccggtc tacctggatc aatacgatgc gtatggcatc       180
     aaggtcacct gtggcagcgg ctggcgctcc aacctcaccc aggcgctgta cgccgacggc       240
     aacgacaaca ctcaggccct ggtcacgcgt tgtgacaccg cactactcgt acgtcgcgcc       300
     tgggcgatcc cgtccgttgc cctggggtgg ttgctggtca ccgggttttt ggtgatgtgg       360
     gtgcacaacg atcaacatca gggccagtcc tatcccggat accgggcata g                411
//

If you have problems or comments...

PBIL Back to PBIL home page