(data stored in ACNUC7421 zone)

EMBL: CP001658.PE435

CP001658.PE435       Location/Qualifiers
FT   CDS_pept        complement(515632..516207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00427"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23456"
FT                   /protein_id="ACT23456.1"
FT                   /translation="MAGLHFESAEQKSRQRCECRVRVNECRTVAKPFVNECSLGQGVIM
FT                   SVVGGTVRTVGRTVSGAATATTAAAGAVGGAAVSGIVGGVTGAAKGIQKGLSSGSKSTA
FT                   AAALAIGAIGVAGLVDWPILLAVGGGALLLRKLNRTPEVAAPPVKAKLAPVPDKPAAAK
FT                   EAPAKASKTTARKTSGRRAGTAELRSTN"
     gtggcaggct tgcatttcga gagcgctgaa cagaaatctc gtcagcggtg cgaatgcagg        60
     gtgcgggtta acgagtgtag aactgtagct aaaccatttg taaacgaatg cagtttgggc       120
     cagggagtca tcatgagtgt ggtcggcggg acagttcgaa ccgtggggcg aacggtgagt       180
     ggtgcagcaa cggcgaccac agcggccgcg ggtgcggtgg gtggcgccgc cgtgagcggc       240
     atcgtcggcg gtgtgaccgg agccgccaaa ggcattcaga aggggcttag cagcggcagc       300
     aagtcgaccg cggcagccgc gttggccatc ggtgcgatcg gtgtcgctgg actcgtcgat       360
     tggccgatcc tgttggccgt gggcggcgga gcgttgctat tgcggaagct caaccgcacc       420
     cccgaggtgg ccgcaccgcc ggtgaaggcg aaacttgcgc cggtgcccga caagccggct       480
     gccgcaaagg aagcgccagc caaagcgagc aagacaacag ccaggaagac gagcggtcgc       540
     cgagcgggca ccgctgagct gcgcagcacc aactag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page