(data stored in ACNUC7421 zone)

EMBL: CP001658.PE436

CP001658.PE436       Location/Qualifiers
FT   CDS_pept        complement(516276..517151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00428"
FT                   /product="exodeoxyribonuclease III protein xthA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23457"
FT                   /protein_id="ACT23457.1"
FT                   /translation="MPDGTIDGGHPQRPASPRLRSPLLRLATWNVNSIRTRLDRVLDWL
FT                   GRADVDVLAMQETKCPDGQFPALPLFELGYDVAHVGFDQWNGVAIASRVGLDDVRVGFD
FT                   GQPSWSGKPEVAATTEARALGATCGGIRVWSLYVPNGRALDDPHYTYKLDWLAALRDTA
FT                   EGWLRDDPAAPIALMGDWNIAPTDDDVWSTEFFAGCTHVSEPERKAFNAIVDAQFTDVV
FT                   RPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAARVMDAQIVREERKGKAPSDH
FT                   APVLVDLHAG"
     atgcccgacg gcacaattga cggcggccac ccccaacgcc cggcttcgcc gcgcttgcga        60
     tcgccgctgc tgcggctggc cacctggaat gtgaattcga ttcgcacccg gttggatcgt       120
     gtcctcgatt ggcttgggcg cgccgatgtc gacgtgttgg ccatgcagga gaccaagtgc       180
     ccggacggcc aattcccggc cttgccgctg ttcgaactcg gctatgacgt cgcacacgtc       240
     ggcttcgatc agtggaacgg cgtggcgatc gcatcccgcg tcggcctcga cgacgtgcgg       300
     gttgggttcg acggccagcc cagctggagc ggcaagccgg aagtggccgc cacgacggag       360
     gcccgtgccc tgggcgccac ctgcggcggc atccgggtgt ggagcctcta cgtgcccaac       420
     gggcgcgccc tggacgatcc gcactacacc tacaagttgg attggcttgc cgcgctgcgt       480
     gatacggccg aaggctggct acgtgacgat cccgccgcac caatcgcact gatgggcgac       540
     tggaacatcg ctccgaccga tgatgatgtc tggagcaccg aattcttcgc cggctgcacg       600
     cacgtttccg aacccgagcg caaggcgttc aacgccattg tcgacgcgca attcaccgat       660
     gtagtacggc ctttcacccc gggacccggg gtttacacct actgggatta cacgcagctg       720
     cggttcccga agaaacaggg catgcgcatc gacttcatcc tcggctcgcc ggcgttggcc       780
     gcccgggtga tggacgccca gatcgtacgc gaggagcgta aaggcaaagc gcccagcgac       840
     cacgctccgg tgctcgtcga cctgcacgcc gggtag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page