(data stored in ACNUC7421 zone)

EMBL: CP001658.PE439

CP001658.PE439       Location/Qualifiers
FT   CDS_pept        518848..519300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23460"
FT                   /protein_id="ACT23460.1"
FT                   /translation="MQASRPTRGQDYRPTVPGVVQYSPKKRLRRPSHSYTLRIRRKGPG
FT                   ESDMDSAMARAIRSGDDAEVADGLTRREHDILAFERQWWKFAGVKEEAIKELFSMSATR
FT                   YYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFEVT"
     gtgcaagcaa gtcggccgac tcgcgggcag gattaccgcc cgacggttcc tggcgtggtt        60
     caatattcgc cgaagaagcg cctacgtagg ccaagtcatt cgtacacatt gagaattcgc       120
     cggaagggcc caggggaaag cgatatggac agcgccatgg cgcgggcaat tcgatcgggg       180
     gacgacgccg aggtcgccga tgggctgacc cggcgcgagc acgacatcct ggcgttcgaa       240
     cgtcagtggt ggaagtttgc cggtgtcaag gaagaagcca tcaaagagtt gttctccatg       300
     tcggcgacgc gctactacca agtgctcaat gcgctggtgg atcggcccga ggcgctggcc       360
     gccgacccga tgctggtaaa gcggttgcgg cggctgcgcg ccagtcggca gaaggcgcgg       420
     gccgcgcgac gccttggctt cgaggtgacc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page