(data stored in ACNUC7421 zone)

EMBL: CP001658.PE450

CP001658.PE450       Location/Qualifiers
FT   CDS_pept        complement(530555..530983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23471"
FT                   /protein_id="ACT23471.1"
FT                   /translation="MGAKKVDLKRLAAALPDYPFAYLITVDDGHRVHTVAVEPVLRELP
FT                   DGPDGPRAVVDVGLIGGRTRQNLAHRSEVTLLWPPSDPSGYSLIVDGRAQASDAGPDDD
FT                   TARCGVVPIRALLHRDAAPDSPTAAKGCLHDCVVFSVP"
     gtgggtgcca aaaaggtaga cctcaaacgg ctggccgccg ccttgcccga ctacccgttc        60
     gcttacctga tcaccgtcga tgatggccat cgcgtgcaca cggtggcagt cgagccggtg       120
     ctgcgcgaac tccccgacgg ccccgatgga ccccgggcag tggtcgacgt cggcctgatc       180
     gggggtcgta cgcggcaaaa cctggcccac cgcagcgaag tcaccctgtt gtggccgcca       240
     tccgatccta gcggctactc gctgatcgtc gacggccgtg cccaggcgtc ggacgcaggc       300
     cccgatgacg acaccgcccg ctgcggtgtc gtacccatcc gcgcgctgct gcaccgagac       360
     gcggcccccg actcgcccac agcggccaaa ggttgcctac acgactgcgt ggtgttctcg       420
     gtaccgtag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page