(data stored in ACNUC7421 zone)

EMBL: CP001658.PE456

CP001658.PE456       Location/Qualifiers
FT   CDS_pept        complement(534950..535486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00447"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23477"
FT                   /protein_id="ACT23477.1"
FT                   /translation="MNIVVVTSVSALAVAVVHSVAFAIGRRIGRYNVVDVVWGLGFVAV
FT                   AVAAATLGHGDPVRRWLLLALVSTWGLRLSWHMYRKTAGQGEDPRYADLLRGATPVQAL
FT                   RKVFGLQGLLTLFVSFPLQLSAVTGPTPKPLLAVGGVGLAVWLVGITFEAVGDWQLWVF
FT                   KSDPANRGVIMDRGL"
     gtgaacatcg tcgtggtaac cagcgtgtcg gctttggctg tggccgtggt gcattcggtg        60
     gcgtttgcga tcggccgccg catcggccgg tacaacgtcg tcgacgtggt atggggcttg       120
     ggtttcgtcg ccgtcgccgt cgccgccgcg acgctcggcc acggcgaccc ggttcgccga       180
     tggctgctac tagcgttggt gtcgacctgg ggtctgcggc tgagctggca catgtaccgc       240
     aagacagccg gtcaggggga ggatccccgc tacgccgacc tgctgcgcgg tgccacgcct       300
     gtgcaggcat tgcgcaaggt cttcggatta cagggcctcc tgacgttgtt cgtctcattc       360
     ccgctgcagc tttccgcagt caccgggccg acgccgaagc cgttactggc tgttgggggc       420
     gtgggcttag ccgtgtggct ggtcggtatc accttcgaag cggtgggaga ttggcaactg       480
     tgggtattca aatccgaccc ggccaatcgc ggggtcatca tggaccgcgg cctgtga          537
//

If you have problems or comments...

PBIL Back to PBIL home page