(data stored in ACNUC7421 zone)

EMBL: CP001658.PE459

CP001658.PE459       Location/Qualifiers
FT   CDS_pept        complement(537488..538807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23480"
FT                   /protein_id="ACT23480.1"
FT                   /translation="MQQSLRRSVAVVGSGVAGLTAAYILSGRDRVTLYEADGRLGGHAH
FT                   THYLDNGGGPRGTDVVGVDSAFLVHNDRTYPTLCRLFAELGVATQESEMSMSVRADDIG
FT                   LEYAGALGARGLFACRQSLRPRYLCMLAEILRFHRAAARLLREETDNAEDKPETLEAFL
FT                   SRHHFSQYFVDYFITPLVAAVWSCGGADALRYPARYLFVFLDHHGMLSVFGSPTWRTVT
FT                   GGSANYVQAIAAQLDEVSTRTPVHSLRRLPDGVLVGAGDGPSRRFDAAVVAVHPDQALL
FT                   LLDEPTPAERAVLGAIAYSTNSAQLHTDESVLPRHHRARASWNYLVTPGQHQVVVSYDI
FT                   SRLMRLDGGRRYLVTLGGHDRVDPSSVIAEMTYSHPLYTPESVAAQRLLPTLGDNRVVF
FT                   AGAYHGWGFHEDGAASGLRAARRLGADWPAAIPQEAMVAC"
     gtgcagcaat cactccgacg atcggtggct gttgtcggaa gtggggtcgc cggcctcacc        60
     gccgcctaca tcctgtctgg acgggaccga gtcaccctgt acgaggcgga cggccggctg       120
     ggcggtcatg cccacaccca ctatctggac aacggtggcg gcccccgggg caccgacgtc       180
     gtcggcgtcg actcggcgtt cctggtgcac aacgaccgaa cctatccaac gttgtgccga       240
     ttgttcgccg aactgggtgt ggccacccag gagtcggaaa tgtcgatgtc ggtgcgcgcc       300
     gacgacatcg gactcgaata tgccggcgca ctgggagcgc gcgggctgtt cgcttgccgg       360
     caatcgctgc ggccacggta tctgtgcatg cttgccgaga ttctccgctt ccaccgcgcc       420
     gcggctcgcc tgctgcgtga ggagaccgac aacgcggaag acaaaccgga gacgctggaa       480
     gccttcctga gccggcacca cttctcgcag tatttcgtcg attacttcat cacacccttg       540
     gtcgccgccg tgtggtcctg cggcggggcc gacgccttgc gctatccggc ccggtatctg       600
     ttcgtcttcc tcgaccatca cggcatgctg tcggtgttcg ggtcgccaac ctggcgtacc       660
     gtcaccggag gttccgccaa ctacgtgcag gcgatcgcag ctcagctgga cgaggtgtcg       720
     acccgcacgc cagtgcactc gctgcgccgg ctgccggacg gggtattggt gggcgcgggt       780
     gatgggccgt cgcggcgttt cgatgcggcc gtcgtcgcgg tccatcccga ccaggcgctg       840
     ctgttgctcg acgagccgac accggccgag cgcgcggtcc tgggcgcgat cgcatactcc       900
     accaacagcg cccagctgca caccgacgag tcggtcctgc cccgccacca tcgcgcccgc       960
     gcatcctgga actacctggt gacacccggg cagcaccagg tcgtggtcag ctacgacatc      1020
     agcaggctaa tgcgcctcga cggtggccgc cggtatctgg tcaccctcgg cggccacgac      1080
     cgggttgatc ccagctcggt gatcgccgag atgacctaca gccatccgct gtacacaccg      1140
     gaatcggttg cagcccaacg cttattgccg acgctgggtg acaatcgggt ggtattcgcc      1200
     ggcgcctacc acggctgggg attccacgag gacggcgccg cctcgggtct gcgggcggcc      1260
     cggcgccttg gcgccgactg gccggcagcg atcccacagg aggcgatggt cgcgtgctga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page