(data stored in ACNUC7421 zone)

EMBL: CP001658.PE464

CP001658.PE464       Location/Qualifiers
FT   CDS_pept        complement(544995..545549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23485"
FT                   /protein_id="ACT23485.1"
FT                   /translation="MGPSAAVRRIDSGDQLRNSHIHHPRNSTTYRVPLGLRPCPTSLLV
FT                   AQPPPATRRDTMPLRGRGKHRGPHGLDTGARRMSQAPGNEIPHTLAALDWGGITCQSGA
FT                   GCTNRASYVVHLHAVDECNDPDLDPFGNTVEILCIACLWHVEAKVLLQVGRLTRSPGAF
FT                   CLTCGAPVREPTDIMRDVAAL"
     ttgggcccat cagccgccgt tcggcggatt gattctggcg accagctacg aaatagtcat        60
     atccatcacc cacggaattc gacgacctat cgcgtaccac taggactaag gccatgcccg       120
     acttcgctct tggtagccca gccaccaccg gccacgcgcc gggataccat gccgttgcgg       180
     ggcagaggta aacatcgtgg gccgcatggc ctggacactg gagcgcggcg catgagtcaa       240
     gcgcccggca acgagatccc acacacgctg gcggccctgg actggggtgg aatcacctgc       300
     cagtccggag ccgggtgcac caaccgggcg agttacgtgg tgcatctgca tgcggtagac       360
     gaatgtaacg accccgacct ggacccattc gggaacaccg tcgaaattct gtgcattgcc       420
     tgcttgtggc acgtcgaggc caaagtcctg cttcaagtcg gtcggctcac ccgttccccg       480
     ggcgcgttct gcctgacctg tggggcgccg gtgcgcgaac ccaccgacat catgcgcgac       540
     gtcgctgcgt tgtag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page