(data stored in ACNUC7421 zone)

EMBL: CP001658.PE471

CP001658.PE471       Location/Qualifiers
FT   CDS_pept        551457..551948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23492"
FT                   /protein_id="ACT23492.1"
FT                   /translation="MNAPAGVLITAEAAALLAGLQDRHGPVMFHQSGGCCDGSAPMCYP
FT                   RADFLVGDRDILLGVLDVGEDGVPVWISGPQYQAWKHTQLIIDVVPGRGGGFSLEAPEG
FT                   VRFLSRGRVFSDAEKAMREAAPVITGAAYECGERPLVRGLVVDLDDPDATPGVCRASRR
FT                   "
     atgaacgctc ccgcgggggt gctcatcacc gccgaggccg ccgcgctgct ggctgggtta        60
     caggaccggc acggtccggt gatgttccac caatccggcg gctgctgcga cgggtccgcg       120
     ccgatgtgct acccgcgggc ggacttcctg gtcggtgacc gcgacatctt gctgggtgtg       180
     ttggacgtcg gggaagacgg cgtgccggtg tggatttcgg gcccgcagta ccaggcctgg       240
     aagcacaccc agctgatcat cgacgtggtg ccgggccgcg gtggcgggtt cagtctggaa       300
     gcgcccgagg gcgtgcgctt tctcagccga ggtcgggtgt tcagcgacgc cgaaaaggcg       360
     atgcgggagg ctgcgccggt gatcaccggc gcagcctacg agtgcggcga acgaccgtta       420
     gtgcggggtc ttgtcgtcga tctcgacgat ccagatgcca cgccgggagt gtgccgcgcc       480
     agtcggcggt ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page