(data stored in ACNUC7421 zone)

EMBL: CP001658.PE473

CP001658.PE473       Location/Qualifiers
FT   CDS_pept        552240..552809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00463"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23494"
FT                   /protein_id="ACT23494.1"
FT                   /translation="MADNDYRSAPGTEPFVPDFDTGAHSQRFLSLAGQQDRAGKSWPGS
FT                   TPKPQEDPVGVAPSASVEVLGSEPAATLAHSVTVPGRYTYLKWWKFVLVVLGVWIGAGE
FT                   VGLSLFYWWYHTLDKTAAVFVVLVYVVACTVGGLILALVPGRPLITALSLGVMSGPFAS
FT                   VAAAAPLYGYYYCERMSHCLVGVIPY"
     gtggctgaca acgattaccg gtcggcaccc ggaaccgagc cgtttgtgcc cgatttcgac        60
     accggcgcac actcgcagcg gttcctctcg ttggccggcc agcaggacag ggcggggaaa       120
     tcctggccag gctcgacgcc gaagccgcag gaggaccccg tgggtgtcgc gccttcggcc       180
     agcgtcgagg tgctggggtc cgagccggcc gccacgctag cgcactcggt tacagtaccc       240
     ggtcgatata cctacctgaa gtggtggaag ttcgttctag tggtcctcgg cgtatggatc       300
     ggtgctggcg aggtcggcct gagcttgttc tactggtggt atcacacact cgacaagacg       360
     gccgccgtgt tcgtcgtcct ggtctacgtc gtcgcgtgca ccgtcggtgg cttgatcctg       420
     gcgctggtgc cgggcaggcc actgatcacg gcgttgtccc tcggagtgat gtcggggccg       480
     tttgcctcgg tcgccgccgc ggcgccgctc tacggctact actactgcga gcggatgagt       540
     cattgcctgg tcggcgtcat tccgtactag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page