(data stored in ACNUC7421 zone)

EMBL: CP001658.PE475

CP001658.PE475       Location/Qualifiers
FT   CDS_pept        554275..554568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00465"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23496"
FT                   /protein_id="ACT23496.1"
FT                   /translation="MTRRASTDTPQIIMGAIGGVVTGYILWLAAISVGDGLTTVSQWSR
FT                   VVLLLSVLVAVCGAAGGLRLRSRGKLAWSAFAFSLPIPPVVLTVAVLADIYL"
     atgacgaggc gcgcgagcac tgacaccccc cagatcatca tgggtgccat cggtggtgtg        60
     gttaccggct acatcctctg gctggcggcg atctccgtcg gcgatggtct gacgacggtg       120
     agtcaatgga gtcgcgtggt gttattgctg tcggtcctgg tggcggtgtg cggcgcggcg       180
     ggcggcttgc ggctgcgcag ccgcggcaag ctcgcgtggt cggcgtttgc tttcagtttg       240
     ccgattcctc ccgtggtgct gaccgtggcg gtgctggccg acatctacct ttga             294
//

If you have problems or comments...

PBIL Back to PBIL home page