(data stored in ACNUC7421 zone)

EMBL: CP001658.PE478

CP001658.PE478       Location/Qualifiers
FT   CDS_pept        556717..557511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23499"
FT                   /protein_id="ACT23499.1"
FT                   /translation="MSLDKKLMPVPDGHPDVFDREWPLRVGDIDRAGRLRLDAACRHIQ
FT                   DIGQDQLREMGFEETHPLWIVRRTMVDLIRPIEFGDMLRCRRWCSGTSNRWCEMRVRVD
FT                   GRKGGLIESEAFWIHVNRETEMPARIADDFLAGLHRTTSVDRLRWKGYLKPGSRDDASE
FT                   IHEFPVRVTDIDLFDHMNNAVYWSVIEDYLASHAELLRGPLRVTIEHEAPVALGDKLEI
FT                   ISHVHPAGSTEIFGPGLVDRAVTTLTYVVGDEPKAVASLFNL"
     gtgagcctcg acaaaaaatt gatgcccgtg cccgacggtc accccgacgt gttcgaccga        60
     gaatggccgc tgcgcgtcgg cgacatcgac cgcgcgggcc ggctgcggct ggacgcggct       120
     tgtcggcaca tccaggacat cggtcaggac caactgcgcg agatgggctt cgaggagacc       180
     cacccgctgt ggatcgtccg caggaccatg gtggacctta tccggccgat cgagttcggc       240
     gacatgctgc ggtgtcggcg ctggtgctcg ggcacctcca accggtggtg tgagatgcga       300
     gttcgtgtcg atggccgcaa gggcggcctg atcgaatccg aggcgttctg gatccacgtc       360
     aaccgggaaa ccgagatgcc ggcccgcatt gccgacgact tcctcgcggg tctgcaccgg       420
     accacgtctg ttgatcggct gcgctggaag ggctatctga agccgggcag ccgggatgat       480
     gcgtcggaga tccacgagtt cccggtccgg gtcaccgata tcgacttgtt cgaccacatg       540
     aacaacgctg tctattggag tgtgatcgag gactacctgg cgtcgcatgc agagctgctg       600
     cggggccctt tgcgggtgac catcgagcat gaggcgccgg ttgcgctcgg cgacaagctg       660
     gagatcatct cccacgttca cccggctggt tcgaccgaga tattcggccc ggggttggtc       720
     gaccgcgctg ttacaacgct cacatatgtg gttggcgacg agcccaaggc agtcgcctcg       780
     ctgttcaatc tgtga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page