(data stored in ACNUC7421 zone)

EMBL: CP001658.PE483

CP001658.PE483       Location/Qualifiers
FT   CDS_pept        complement(562113..562553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23504"
FT                   /protein_id="ACT23504.1"
FT                   /translation="MGAGGWEVVLASLPYGLLCTTVLMGKHIDKIGYDEPLGIRTLPVL
FT                   LGETCARTVTLAMMVGFYLLIAVNVMLAAMPWPRCWSPGRCPGWRKCGPISCDGGPSSR
FT                   HRRFRCGRCGMPRWPGCTCVRPVRCWLWAWRSVPGGAPGDFR"
     gtgggcgcgg gcggttggga ggtcgtgctg gcgtcgctcc cctacgggct gttgtgcacc        60
     acggtgctga tgggtaagca catcgacaag atcggttacg acgaaccgct gggtatccga       120
     acgctgccgg tgctactcgg cgaaacgtgc gcgcgcaccg tgacactggc catgatggtc       180
     ggcttctacc tacttatcgc cgtaaacgtc atgctggctg ccatgccctg gccgcgttgc       240
     tggtcgccgg ggcgctgccc cggctggcga aagtgtggcc ctatttcctg cgacggcggc       300
     cccagcagcc gccaccggcg tttccggtgt ggccgctgtg gtatgccgcg ttggcctggc       360
     tgcacgtgcg tcaggccggt gcgctgctgg ttgtgggcct ggcgatcggt gcctggcggc       420
     gcgcctggtg attttcgctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page