(data stored in ACNUC7421 zone)

EMBL: CP001658.PE484

CP001658.PE484       Location/Qualifiers
FT   CDS_pept        complement(562484..562972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23505"
FT                   /protein_id="ACT23505.1"
FT                   /translation="MPDAGAGSRLRSWAYALRTTNPPADGPTDTVTRWLVVTRAAVLPM
FT                   TLVSGLVAGLLAIGEPGLDWRWLVLWWESHAPHIANNLMNDLYDTDVGTDSATYARARY
FT                   AQHPAATGANRAAYTTPRRTTSCGSPERALEPTTPRWARAVGRSCWRRSPTGCCAPRC"
     atgcccgacg cgggcgcggg ctcccggctc agatcgtggg cctacgcact tcgcaccacc        60
     aacccgccag ctgacgggcc gaccgacacg gtcacccggt ggctcgtcgt cacccgggcc       120
     gcagtgctgc cgatgaccct ggtctccggc ctggtcgcgg ggctgttggc gatcggcgag       180
     cctggcttgg attggcgctg gctcgtcctg tggtgggaat cacatgcgcc gcacatcgcc       240
     aacaacctta tgaacgatct ctacgacacc gatgtcggta ctgacagcgc cacctacgcg       300
     cgcgcccgct atgcccagca cccggccgct accggggcca accgtgccgc atataccacg       360
     cctcgacgaa ccaccagctg cggctcaccc gagcgtgcgc tggaacctac tacgccgcgg       420
     tgggcgcggg cggttgggag gtcgtgctgg cgtcgctccc ctacgggctg ttgtgcacca       480
     cggtgctga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page