(data stored in ACNUC7421 zone)

EMBL: CP001658.PE49

CP001658.PE49        Location/Qualifiers
FT   CDS_pept        52913..53347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23070"
FT                   /protein_id="ACT23070.1"
FT                   /translation="MRLQRQVVDYTLRRRSLLAEVYSGRTGVSEVCDANPYLLRAAKFH
FT                   GKPSRVICPICRKEQLTLVSWVFGEHLGAVSGSARTAEELILLATRFSEFAVHVVEVCR
FT                   TCSWNHLVKSYVLGAARPARPPRGSGGTRTARNGARTASE"
     gtgcgactgc agcgacaggt agtggactac acgctacggc gacgctccct gctggccgag        60
     gtgtattcgg gacgcaccgg tgtgtcggag gtgtgcgacg ccaaccccta cctgctgcgc       120
     gccgcaaagt ttcatgggaa gcccagccgg gtcatctgcc cgatctgccg caaggagcag       180
     ctcacactgg tgtcgtgggt gttcggcgag cacctcggtg cggtatcagg gtccgcgcgc       240
     accgccgaag aactgatcct gctggcgacc cggttctccg agttcgcggt ccacgtggtg       300
     gaggtatgtc gaacctgcag ttggaatcat ctggtcaagt catacgtcct gggcgccgca       360
     cgtccggcac gcccccctag ggggtctggc gggacgcgga cggcgcgcaa cggggcccgc       420
     acggccagtg aatag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page