(data stored in ACNUC7421 zone)

EMBL: CP001658.PE494

CP001658.PE494       Location/Qualifiers
FT   CDS_pept        complement(570191..570715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23515"
FT                   /protein_id="ACT23515.1"
FT                   /translation="MPRSFDMSADYEGSVEEVHRAFYEADYWKARLAETPVDVATLESI
FT                   RVGGDSGDDGTIEVVTLQMVRSHNLPGLVTQLHRGDLSVRREETWGPVKEGIATASIAG
FT                   SIVDAPVNLWGTAVLSPIPESGGSRMTLQVTIQVRIPFIGGKLERLIGTQLSQLVTIEQ
FT                   RFTTLWITNNV"
     atgccgcgtt cattcgacat gtcggccgac tacgagggca gcgtcgagga ggttcatcgg        60
     gctttctacg aggcggacta ctggaaagcc agactggccg aaacgccggt cgacgtcgcg       120
     acccttgagt cgatacgcgt aggtggcgac tccggagacg acggcaccat cgaagtcgtc       180
     accctgcaga tggtgcgcag tcacaatctg cccggcctgg tcacacagtt gcaccggggc       240
     gatctttcgg tacggcgcga ggagacctgg ggcccggtca aggaaggcat cgcgaccgcg       300
     tccattgcgg gatcgatcgt ggacgctccg gtgaacttgt ggggcaccgc cgtgctctcg       360
     cccataccgg agtcgggtgg ctcccgaatg acgctgcagg tcaccatcca ggtgcgtatc       420
     ccgttcattg gcgggaagct ggagaggctt atcggcaccc aattaagcca gctagtgacc       480
     atcgaacagc gcttcaccac gctgtggatc acgaacaacg tctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page