(data stored in ACNUC7421 zone)

EMBL: CP001658.PE50

CP001658.PE50        Location/Qualifiers
FT   CDS_pept        53340..55802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00049"
FT                   /product="bifunctional penicillin-binding protein ponA1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23071"
FT                   /protein_id="ACT23071.1"
FT                   /translation="MNSDGRHHQSSSGAPRGPANPGQRGQVPPDDRLTAILPPVTDDRS
FT                   APHADSIEAVKAALDGAPPMPPPRDPLEEVTAALAAPPGKPPRGDQLGGRRRPPGPPGP
FT                   PGSSGQPAGRLPQPRVDLPRVGQINWKWIRRSLYLTAAVVILLPMVTFTMAYLIVDVPK
FT                   PGDIRTNQVSTILASDGSEIAKIVPPEGNRVDVNLSQVPMHVRQAVIAAEDRNFYSNPG
FT                   FSFTGFARAVKNNLFGGDLQGGSTITQQYVKNALVGSAQHGWSGLMRKAKELVIATKMS
FT                   GEWSKDDVLQAYLNIIYFGRGAYGISAASKAYFDKPVEQLTVAEGALLAALIRRPSTLD
FT                   PAVDPEGAHARWNWVLDGMVETKALSPNDRAAQVFPETVPPDLARAENQTKGPNGLIER
FT                   QVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSID
FT                   PHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDG
FT                   IKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVA
FT                   HTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLF
FT                   DASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANK
FT                   DAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNET
FT                   FPKPTEVGGYAGVPPPPPPSEVPPSETVIQPTVEIAPGITIPIGPPTTITLAPPPPAPP
FT                   AATPTPPP"
     gtgaatagcg acgggcgtca ccatcagtcg tccagcggcg ccccgcgcgg gccggcgaat        60
     cccggccagc gtggtcaggt tccacccgac gacagactga ccgcgatcct cccgccggtg       120
     accgatgacc gatcggctcc gcacgcggac tccatcgagg cggtcaaggc cgcgctcgac       180
     ggcgcgccgc cgatgccccc gccgcgcgac ccgctcgagg aggtcacggc cgcgttggcc       240
     gccccgcccg gtaaaccgcc gcggggggat cagcttggtg gcagacgtcg cccaccgggg       300
     ccgcccgggc cccccggttc gtccggacag cctgccggcc ggctgcccca accgagggtg       360
     gacttgcccc gggtcggcca gatcaactgg aaatggatac ggcgttcgct gtacctcacc       420
     gcggcggtgg tgatcctgtt gccgatggtc accttcacga tggcctacct gatcgtcgac       480
     gttcccaagc caggtgacat ccgtaccaac caggtctcca cgatccttgc cagcgacggc       540
     tcggaaatcg ccaaaattgt tccgcccgaa ggtaatcggg tcgacgtcaa cctcagccag       600
     gtgccgatgc atgtgcgcca ggcggtgatt gcggccgaag accgcaattt ctattcgaat       660
     ccgggattct cgttcaccgg cttcgcgcgg gcagtcaaga acaacctgtt cggcggcgat       720
     ctgcagggcg gatcgacgat tacccagcag tacgtcaaga acgcgctggt cggttccgca       780
     cagcacgggt ggagcggtct gatgcgcaag gcgaaagaat tggtcatcgc gacgaagatg       840
     tcgggggagt ggtctaaaga cgatgtgctg caggcgtatc tgaacatcat ctacttcggc       900
     cggggcgcct acggcatttc ggcggcgtcc aaggcttatt tcgacaagcc cgtcgagcag       960
     ctgaccgttg ccgaaggggc gttgttggca gcgctgattc ggcggccttc gacgctggac      1020
     ccggcggtcg accccgaagg ggcccatgcc cgctggaatt gggtactcga cggcatggtg      1080
     gaaaccaagg ctctctcgcc gaatgaccgt gcggcgcagg tgtttcccga gacagtgccg      1140
     cccgatctgg cccgggcaga gaatcagacc aaaggaccca acgggctgat cgagcggcag      1200
     gtgacaaggg agttgctcga gctgttcaac atcgacgagc agaccctcaa cacccagggg      1260
     ctggtggtca ccaccacgat tgatccgcag gcccaacggg cggcggagaa ggcggttgcg      1320
     aaatacctgg acgggcagga ccccgacatg cgtgccgccg tggtttccat cgacccgcac      1380
     aacggggcgg tgcgtgcgta ctacggtggc gacaatgcca atggctttga cttcgctcaa      1440
     gcgggattgc agactggatc gtcgtttaag gtgtttgctc tggtggccgc ccttgagcag      1500
     gggatcggcc tgggctacca ggtagacagc tctccgttga cggtcgacgg catcaagatc      1560
     accaacgtcg agggcgaggg ttgcgggacg tgcaacatcg ccgaggcgct caaaatgtcg      1620
     ctgaacacct cctactaccg gctgatgctc aagctcaacg gcggcccaca ggctgtggcc      1680
     gatgccgcgc accaagccgg cattgcctcc agcttcccgg gcgttgcgca cacgctgtcc      1740
     gaagatggca agggtggacc gcccaacaac gggatcgtgt tgggccagta ccaaacccgg      1800
     gtgatcgaca tggcatcggc gtatgccacg ttggccgcgt ccggtatcta ccacccgccg      1860
     catttcgtac agaaggtggt cagtgccaac ggccaggtcc tcttcgacgc cagcaccgcg      1920
     gacaacaccg gcgatcagcg catccccaag gcggtagccg acaacgtgac tgcggcgatg      1980
     gagccgatcg caggttattc gcgtggccac aacctagcgg gtgggcggga ttcggcggcc      2040
     aagaccggca ctacgcaatt tggtgacacc accgcgaaca aagacgcctg gatggtcggg      2100
     tacacgccgt cgttgtctac ggctgtgtgg gtgggcaccg tcaagggtga cgagccactg      2160
     gtaaccgctt cgggtgcagc gatttacggc tcgggcctgc cgtcggacat ctggaaggca      2220
     accatggacg gcgccttgaa gggcacgtcg aacgagactt tccccaaacc gaccgaggtc      2280
     ggtggttatg ccggtgtgcc gccgccgccg ccgccgtcgg aggtaccacc ttcggagacc      2340
     gtcatccagc ccacggtcga aattgcgccg gggattacca tcccgatcgg tcccccgacc      2400
     accattaccc tggcgccacc gcccccggcc ccgcccgctg cgactcccac gccgccgccg      2460
     tga                                                                    2463
//

If you have problems or comments...

PBIL Back to PBIL home page