(data stored in ACNUC7421 zone)

EMBL: CP001658.PE500

CP001658.PE500       Location/Qualifiers
FT   CDS_pept        576990..577541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23521"
FT                   /protein_id="ACT23521.1"
FT                   /translation="MTSSLPTVQRVIQNALEVSQLKYSQHPRPGGAPPALIVELPGERK
FT                   LKINTILSVGEHSVRVEAFVCRKPDENREDVYRFLLRRNRRLYGVAYTLDNVGDIYLVG
FT                   QMALSAVDADEVDRVLGQVLEVVDSDFNALLELGFRSSIQREWQWRLSRGESLQNLQAF
FT                   AHLRPTTMQSAQRDEKELGG"
     gtgacttcct ccttgccgac cgtgcaacgt gtgatccaga atgcgctcga ggtcagccag        60
     ctgaagtact cccaacaccc ccgcccgggc ggggcgccgc ccgcgctgat cgtcgagctg       120
     ccgggcgaac gcaagctcaa gatcaacacc atcctgagcg tcggcgagca ttcggtgcgt       180
     gtcgaggcgt tcgtgtgtcg caagcctgac gagaaccgcg aagacgtata ccggttcctg       240
     ctgcggcgca accgccgcct gtatggggtc gcgtacacgc tggacaatgt cggcgacatc       300
     tacctggtgg gccagatggc gctgtccgca gtggacgccg acgaggttga ccgggtgttg       360
     gggcaggtgt tagaggtggt ggattcggac ttcaatgcgt tgttggagtt gggatttcgg       420
     tcgtcgattc aacgagagtg gcagtggcgg ttatctcgcg gtgagtcgct gcagaacctg       480
     caggccttcg ctcacttacg cccgacgacg atgcagagcg cgcagcgcga tgagaaggag       540
     ttgggcggtt ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page