(data stored in ACNUC7421 zone)

EMBL: CP001658.PE501

CP001658.PE501       Location/Qualifiers
FT   CDS_pept        577846..578472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00491"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23522"
FT                   /protein_id="ACT23522.1"
FT                   /translation="MFVGFVAMMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGA
FT                   LIAAGVGGFAALIHAHPNMTLVARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALI
FT                   GVVQMCLVVTFLNPHVYLDTVVLIGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGR
FT                   LQPFFATPAAWRILDALVAVTMIGVAVVVLVTSPSVPTANVALII"
     gtgtttgtcg gcttcgttgc catgatgacg ctcaaggtcg cgatcggccc gcaaaacgca        60
     tttgtcctgc gccaaggaat taggcgagaa tacgtgctgg tcattgtggc gctgtgcggg       120
     atcgctgatg gggcactgat tgccgcgggc gttggcggct tcgctgcgct gattcacgct       180
     catcccaata tgactttggt tgcccgattt ggcggcgcag cgttcttgat tggctacgcg       240
     ctattggccg cgcggaacgc gtggcgcccg agcgggctgg tgccgtcgga atcggggccg       300
     gctgcgctga tcggcgtggt gcaaatgtgc ctggtggtga cctttctcaa cccacacgtc       360
     tatctggaca ctgtggtgtt gatcggtgcc ctcgccaatg aggaatcaga tctgcggtgg       420
     tttttcggag ccggtgcctg ggccgccagc gtcgtatggt tcgccgtgtt gggatttagc       480
     gcgggccggc tacagccatt cttcgcaact ccagctgctt ggcgcattct tgatgcgctg       540
     gttgccgtga cgatgattgg ggtcgccgtc gttgtgctcg tcacgtcacc aagtgtgccg       600
     acggccaatg tcgcactgat catttga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page